Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTV3WXYE)

DOT Name	POTE ankyrin domain family member F (POTEF)
Synonyms	ANKRD26-like family C member 1B; Chimeric POTE-actin protein
Gene Name	POTEF
Related Disease	Gastrin-producing neuroendocrine tumor ( ) Acute myelogenous leukaemia ( ) Adrenoleukodystrophy ( ) Adult glioblastoma ( ) Advanced cancer ( ) Bone osteosarcoma ( ) Breast cancer ( ) Breast carcinoma ( ) Breast neoplasm ( ) Carcinoma ( ) CLN2 Batten disease ( ) Colon cancer ( ) Colorectal carcinoma ( ) Deafness dystonia syndrome ( ) Dystonia ( ) Epithelial ovarian cancer ( ) Fatty liver disease ( ) Fetal growth restriction ( ) Glioblastoma multiforme ( ) Hepatitis B virus infection ( ) Hepatitis C virus infection ( ) Hepatocellular carcinoma ( ) Influenza ( ) Liver cirrhosis ( ) Lung cancer ( ) Lung carcinoma ( ) MALT lymphoma ( ) Non-small-cell lung cancer ( ) Obesity ( ) Osteosarcoma ( ) Prostate carcinoma ( ) Rheumatoid arthritis ( ) Schizophrenia ( ) Tuberculosis ( ) Colon carcinoma ( ) Melanoma ( ) Neoplasm ( ) Severe combined immunodeficiency ( ) Squamous cell carcinoma ( ) Type-1/2 diabetes ( ) Adenocarcinoma ( ) Alzheimer disease ( ) Childhood acute lymphoblastic leukemia ( ) Choroideremia ( ) Diabetic kidney disease ( ) Prostate cancer ( ) Systemic lupus erythematosus ( )
UniProt ID	POTEF_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00022 ; PF12796 ; PF14915
Sequence	MVVEVDSMPAASSVKKPFGLRSKMGKWCCRCFPCCRESGKSNVGTSGDHDDSAMKTLRSK MGKWCRHCFPCCRGSGKSNVGASGDHDDSAMKTLRNKMGKWCCHCFPCCRGSSKSKVGAW GDYDDSAFMEPRYHVRGEDLDKLHRAAWWGKVPRKDLIVMLRDTDVNKQDKQKRTALHLA SANGNSEVVKLLLDRRCQLNVLDNKKRTALIKAVQCQEDECALMLLEHGTDPNIPDEYGN TTLHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLLLGVHEQKQQVVKFLIKKKANLNA LDRYGRTALILAVCCGSASIVSLLLEQNIDVSSQDLSGQTAREYAVSSHHHVICQLLSDY KEKQMLKISSENSNPEQDLKLTSEEESQRFKGSENSQPEKMSQEPEINKDGDREVEEEMK KHESNNVGLLENLTNGVTAGNGDNGLIPQRKSRTPENQQFPDNESEEYHRICELLSDYKE KQMPKYSSENSNPEQDLKLTSEEESQRLKGSENGQPEKRSQEPEINKDGDRELENFMAIE EMKKHRSTHVGFPENLTNGATAGNGDDGLIPPRKSRTPESQQFPDTENEEYHSDEQNDTQ KQFCEEQNTGILHDEILIHEEKQIEVVEKMNSELSLSCKKEKDILHENSTLREEIAMLRL ELDTMKHQSQLREKKYLEDIESVKKRNDNLLKALQLNELTMDDDTAVLVIDNGSGMCKAG FAGDDAPRAVFPSIVGRPRQQGMMGGMHQKESYVGKEAQSKRGILTLKYPMEHGIITNWD DMEKIWHHTFYNELRVAPEEHPVLLTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVL SLYTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELPDYLMKILTEHGYRF TTMAEREIVRDIKEKLCYVALDFEQEMATVASSSSLEKSYELPDGQVITIGNERFRCPEA LFQPCFLGMESCGIHETTFNSIMKSDVDIRKDLYTNTVLSGGTTMYPGMAHRMQKEIAAL APSMMKIRIIAPPKRKYSVWVGGSILASLSTFQQMWISKQEYDESGPSIVHRKCL
Tissue Specificity	Expressed in breast cancer cell lines (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Gastrin-producing neuroendocrine tumor	DIS8TYKO	Definitive	Biomarker	[1]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[2]
Adrenoleukodystrophy	DISTUD1F	Strong	Biomarker	[3]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[4]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[5]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[7]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[8]
Carcinoma	DISH9F1N	Strong	Altered Expression	[9]
CLN2 Batten disease	DISZC5YB	Strong	Biomarker	[10]
Colon cancer	DISVC52G	Strong	Biomarker	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[12]
Deafness dystonia syndrome	DIS0480U	Strong	Genetic Variation	[13]
Dystonia	DISJLFGW	Strong	Altered Expression	[13]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[14]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[15]
Fetal growth restriction	DIS5WEJ5	Strong	Altered Expression	[16]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[4]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[17]
Hepatitis C virus infection	DISQ0M8R	Strong	Genetic Variation	[17]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[18]
Influenza	DIS3PNU3	Strong	Genetic Variation	[19]
Liver cirrhosis	DIS4G1GX	Strong	Biomarker	[3]
Lung cancer	DISCM4YA	Strong	Altered Expression	[20]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[20]
MALT lymphoma	DIS1AVVE	Strong	Biomarker	[21]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[22]
Obesity	DIS47Y1K	Strong	Altered Expression	[23]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[6]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[24]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[25]
Schizophrenia	DISSRV2N	Strong	Altered Expression	[26]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[25]
Colon carcinoma	DISJYKUO	moderate	Biomarker	[11]
Melanoma	DIS1RRCY	moderate	Biomarker	[27]
Neoplasm	DISZKGEW	moderate	Altered Expression	[28]
Severe combined immunodeficiency	DIS6MF4Q	moderate	Biomarker	[29]
Squamous cell carcinoma	DISQVIFL	moderate	Altered Expression	[30]
Type-1/2 diabetes	DISIUHAP	moderate	Biomarker	[31]
Adenocarcinoma	DIS3IHTY	Limited	Altered Expression	[32]
Alzheimer disease	DISF8S70	Limited	Altered Expression	[33]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Limited	Biomarker	[34]
Choroideremia	DISH4N9B	Limited	Altered Expression	[35]
Diabetic kidney disease	DISJMWEY	Limited	Altered Expression	[36]
Prostate cancer	DISF190Y	Limited	Biomarker	[24]
Systemic lupus erythematosus	DISI1SZ7	Limited	Biomarker	[37]
------------------------------------------------------------------------------------


⏷ Show the Full List of 47 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of POTE ankyrin domain family member F (POTEF).	[38]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of POTE ankyrin domain family member F (POTEF).	[40]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of POTE ankyrin domain family member F (POTEF).	[44]
------------------------------------------------------------------------------------

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of POTE ankyrin domain family member F (POTEF).	[39]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of POTE ankyrin domain family member F (POTEF).	[41]
Dopamine	DMPGUCF	Approved	Dopamine increases the expression of POTE ankyrin domain family member F (POTEF).	[42]
Nabiximols	DMHKJ5I	Phase 3	Nabiximols decreases the expression of POTE ankyrin domain family member F (POTEF).	[43]
------------------------------------------------------------------------------------

References

1	Secretin-receptor and secretin-receptor-variant expression in gastrinomas: correlation with clinical and tumoral features and secretin and calcium provocative test results.J Clin Endocrinol Metab. 2007 Nov;92(11):4394-402. doi: 10.1210/jc.2007-0986. Epub 2007 Aug 21.
2	Elevated MLF1 expression correlates with malignant progression from myelodysplastic syndrome.Leukemia. 2000 Oct;14(10):1757-65. doi: 10.1038/sj.leu.2401897.
3	Housekeeping gene variability in the liver of alcoholic patients.Alcohol Clin Exp Res. 2012 Feb;36(2):258-66. doi: 10.1111/j.1530-0277.2011.01627.x. Epub 2011 Sep 13.
4	GAPDH is not regulated in human glioblastoma under hypoxic conditions.BMC Mol Biol. 2007 Jun 27;8:55. doi: 10.1186/1471-2199-8-55.
5	Fabrication of 3D continuous-flow reverse-transcription polymerase chain reaction microdevice integrated with on-chip fluorescence detection for semi-quantitative assessment of gene expression.Analyst. 2018 Nov 19;143(23):5692-5701. doi: 10.1039/c8an01739e.
6	Identification of valid reference housekeeping genes for gene expression analysis in tumor neovascularization studies.Clin Transl Oncol. 2013 Mar;15(3):211-8. doi: 10.1007/s12094-012-0904-1. Epub 2012 Jul 25.
7	Effects of Histone Deacetylase Inhibitor (HDACi); Trichostatin-A (TSA) on the expression of housekeeping genes.Mol Cell Probes. 2006 Apr;20(2):81-6. doi: 10.1016/j.mcp.2005.09.008. Epub 2005 Dec 2.
8	Increased levels of alpha-class and pi-class glutathione S-transferases in cell lines resistant to 1-chloro-2,4-dinitrobenzene.Eur J Biochem. 1993 Oct 15;217(2):671-6. doi: 10.1111/j.1432-1033.1993.tb18292.x.
9	Quantitative analysis of TGF-alpha and EGFR mRNA in laryngeal carcinoma tissues.Chin Med J (Engl). 1999 Dec;112(12):1088-92.
10	Gene Therapy Corrects Brain and Behavioral Pathologies in CLN6-Batten Disease.Mol Ther. 2019 Oct 2;27(10):1836-1847. doi: 10.1016/j.ymthe.2019.06.015. Epub 2019 Jul 10.
11	Identification of TMEM208 and PQLC2 as reference genes for normalizing mRNA expression in colorectal cancer treated with aspirin.Oncotarget. 2017 Apr 4;8(14):22759-22771. doi: 10.18632/oncotarget.15191.
12	Novel reference genes in colorectal cancer identify a distinct subset of high stage tumors and their associated histologically normal colonic tissues.BMC Med Genet. 2019 Aug 13;20(1):138. doi: 10.1186/s12881-019-0867-y.
13	Dystonia-deafness syndrome caused by ACTB p.Arg183Trp heterozygosity shows striatal dopaminergic dysfunction and response to pallidal stimulation.J Neurodev Disord. 2018 May 22;10(1):17. doi: 10.1186/s11689-018-9235-z.
14	Selection of suitable reference genes for gene expression studies in normal human ovarian tissues, borderline ovarian tumours and ovarian cancer.Mol Med Rep. 2016 Dec;14(6):5725-5731. doi: 10.3892/mmr.2016.5933. Epub 2016 Nov 8.
15	Roles of Autophagy and Protein Kinase C-epsilon in Lipid Metabolism of Nonalcoholic Fatty Liver Cell Models.Arch Med Res. 2018 Aug;49(6):381-390. doi: 10.1016/j.arcmed.2018.11.006. Epub 2018 Dec 17.
16	Down-regulation of placental neuropilin-1 in fetal growth restriction.Am J Obstet Gynecol. 2016 Feb;214(2):279.e1-279.e9. doi: 10.1016/j.ajog.2015.09.068. Epub 2015 Sep 26.
17	Development of novel triplex single-step real-time PCR assay for detection of Hepatitis Virus B and C simultaneously.Virology. 2016 May;492:101-7. doi: 10.1016/j.virol.2016.01.029. Epub 2016 Feb 22.
18	Overexpression of interleukin-32 promotes invasion by modulating VEGF in hepatocellular carcinoma.Oncol Rep. 2018 Mar;39(3):1155-1162. doi: 10.3892/or.2017.6162. Epub 2017 Dec 19.
19	Enhanced resistancy of thioredoxin-transgenic mice against influenza virus-induced pneumonia.Immunol Lett. 2002 Jun 3;82(1-2):165-70. doi: 10.1016/s0165-2478(02)00033-0.
20	RET expression and detection of KIF5B/RET gene rearrangements in Japanese lung cancer.Cancer Med. 2012 Aug;1(1):68-75. doi: 10.1002/cam4.13. Epub 2012 Jul 12.
21	Translocation t(11;18)(q21;q21) in gastric B-cell lymphomas.Cancer Sci. 2009 May;100(5):881-7. doi: 10.1111/j.1349-7006.2009.01128.x. Epub 2009 Mar 23.
22	Identification of suitable reference genes for gene expression studies using quantitative polymerase chain reaction in lung cancer in vitro.Mol Med Rep. 2015 May;11(5):3767-73. doi: 10.3892/mmr.2015.3159. Epub 2015 Jan 8.
23	Uncoupling protein gene: quantification of expression levels in adipose tissues of obese and non-obese humans.J Lipid Res. 1997 Oct;38(10):2125-33.
24	Purification and Functional Characterization of the C-Terminal Domain of the -Actin-Binding Protein AIM1 In Vitro.Molecules. 2018 Dec 11;23(12):3281. doi: 10.3390/molecules23123281.
25	Mir223 restrains autophagy and promotes CNS inflammation by targeting ATG16L1.Autophagy. 2019 Mar;15(3):478-492. doi: 10.1080/15548627.2018.1522467. Epub 2018 Sep 22.
26	Reduced myelin basic protein and actin-related gene expression in visual cortex in schizophrenia.PLoS One. 2012;7(6):e38211. doi: 10.1371/journal.pone.0038211. Epub 2012 Jun 1.
27	hShroom1 links a membrane bound protein to the actin cytoskeleton.Cell Mol Life Sci. 2009 Feb;66(4):681-96. doi: 10.1007/s00018-009-8645-1.
28	Cell-type specificity of -actin expression and its clinicopathological correlation in gastric adenocarcinoma.World J Gastroenterol. 2014 Sep 14;20(34):12202-11. doi: 10.3748/wjg.v20.i34.12202.
29	Newborn screening for severe combined immunodeficiency: Evaluation of a commercial T-cell receptor excision circle-based method in Victorian dried blood spots.J Paediatr Child Health. 2018 Jan;54(1):14-19. doi: 10.1111/jpc.13659. Epub 2017 Sep 1.
30	MRP3 gene expression correlates with NRF2 mutations in lung squamous cell carcinomas.Mol Med Rep. 2012 Oct;6(4):705-8. doi: 10.3892/mmr.2012.979. Epub 2012 Jul 5.
31	Transgenic overexpression of the sarcoplasmic reticulum Ca2+ATPase improves reticular Ca2+ handling in normal and diabetic rat hearts.FASEB J. 2002 Oct;16(12):1657-9. doi: 10.1096/fj.01-1019fje. Epub 2002 Aug 21.
32	Comparison of glutathione S-transferase-Pi expression at mRNA levels in oesophageal mucosa using RT-PCR-ELISA in individuals with reflux diseases, adenocarcinoma and squamous cell carcinoma.Clin Biochem. 2006 Oct;39(10):997-1001. doi: 10.1016/j.clinbiochem.2006.06.010. Epub 2006 Jul 21.
33	Changes of hippocampus proteomic profiles after blueberry extracts supplementation in APP/PS1 transgenic mice.Nutr Neurosci. 2020 Jan;23(1):75-84. doi: 10.1080/1028415X.2018.1471251. Epub 2018 May 21.
34	Molecular quantification of response to therapy and remission status in TEL-AML1-positive childhood ALL by real-time reverse transcription polymerase chain reaction.Cancer Res. 2001 Mar 15;61(6):2517-22.
35	Use of induced pluripotent stem cell models to probe the pathogenesis of Choroideremia and to develop a potential treatment.Stem Cell Res. 2018 Mar;27:140-150. doi: 10.1016/j.scr.2018.01.009. Epub 2018 Jan 28.
36	Renal in situ hybridization studies of extracellular matrix related molecules in type 1 diabetes mellitus.Nephron. 2002;92(3):564-72. doi: 10.1159/000064110.
37	Upregulated expression of STAT3/IL-17 in patients with systemic lupus erythematosus.Clin Rheumatol. 2019 May;38(5):1361-1366. doi: 10.1007/s10067-019-04467-8. Epub 2019 Feb 15.
38	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
39	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
40	Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
41	Proteomic identification of differentially expressed proteins associated with the multiple drug resistance in methotrexate-resistant human breast cancer cells. Int J Oncol. 2014 Jul;45(1):448-58.
42	Mitochondrial proteomics investigation of a cellular model of impaired dopamine homeostasis, an early step in Parkinson's disease pathogenesis. Mol Biosyst. 2014 Jun;10(6):1332-44.
43	Clinical response to Nabiximols correlates with the downregulation of immune pathways in multiple sclerosis. Eur J Neurol. 2018 Jul;25(7):934-e70. doi: 10.1111/ene.13623. Epub 2018 Apr 16.
44	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.