Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVGI9HT)

• DOT Name: Keratin, type II cytoskeletal 5 (KRT5)
• Synonyms: 58 kDa cytokeratin; Cytokeratin-5; CK-5; Keratin-5; K5; Type-II keratin Kb5
• Gene Name: KRT5
• Related Disease:
  Epidermolysis bullosa simplex 1A, generalized severe
  Advanced cancer
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Dowling-Degos disease 1
  Endometrial carcinoma
  Epidermolysis bullosa
  Epidermolysis bullosa simplex 1B, generalized intermediate
  Epidermolysis bullosa simplex 1C, localized
  Epidermolysis bullosa simplex 1D, generalized, intermediate or severe, autosomal recessive
  Epidermolysis bullosa simplex 2B, generalized intermediate
  Epidermolysis bullosa simplex 2d, generalized, intermediate or severe, autosomal recessive
  Epidermolysis bullosa simplex 2F, with mottled pigmentation
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Head-neck squamous cell carcinoma
  Lung adenocarcinoma
  Lung cancer
  Lung carcinoma
  Mesothelioma
  Osteoarthritis
  Ovarian cancer
  Ovarian neoplasm
  Skin disease
  Skin neoplasm
  Urinary bladder cancer
  Urinary bladder neoplasm
  Adrenocortical carcinoma
  Carcinoma
  High blood pressure
  Dowling-Degos disease
  Epidermolysis bullosa simplex 2E, with migratory circinate erythema
  Rheumatoid arthritis
  Basal cell carcinoma
  Basal cell neoplasm
  Breast neoplasm
  Colorectal carcinoma
  Coronary heart disease
  Nasopharyngeal carcinoma
  Non-small-cell lung cancer
  Squamous cell carcinoma
  Triple negative breast cancer
  Type-1/2 diabetes
  Undifferentiated carcinoma
• UniProt ID: K2C5_HUMAN
• PDB ID: 3TNU; 6JFV
• Pfam ID: PF00038 ; PF16208
• Sequence:
  MSRQSSVSFRSGGSRSFSTASAITPSVSRTSFTSVSRSGGGGGGGFGRVSLAGACGVGGY
  GSRSLYNLGGSKRISISTSGGSFRNRFGAGAGGGYGFGGGAGSGFGFGGGAGGGFGLGGG
  AGFGGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPSIQRVRTEEREQIKTLNNKFA
  SFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRL
  DSELRNMQDLVEDFKNKYEDEINKRTTAENEFVMLKKDVDAAYMNKVELEAKVDALMDEI
  NFMKMFFDAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESW
  YQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQR
  GELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECR
  LSGEGVGPVNISVVTSSVSSGYGSGSGYGGGLGGGLGGGLGGGLAGGSSGSYYSSSSGGV
  GLGGGLSVGGSGFSASSGRGLGVGFGSGGGSSSSVKFVSTTSSSRKSFKS
• Function: Required for the formation of keratin intermediate filaments in the basal epidermis and maintenance of the skin barrier in response to mechanical stress. Regulates the recruitment of Langerhans cells to the epidermis, potentially by modulation of the abundance of macrophage chemotactic cytokines, macrophage inflammatory cytokines and CTNND1 localization in keratinocytes.
• Tissue Specificity: Expressed in corneal epithelium (at protein level) . Expressed in keratinocytes (at protein level) .
• Reactome Pathway:
  Keratinization (R-HSA-6805567)
  Formation of the cornified envelope (R-HSA-6809371)
  Type I hemidesmosome assembly (R-HSA-446107)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Epidermolysis bullosa simplex 1A, generalized severe	DISD362G	Definitive	Autosomal dominant	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[3]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[4]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[4]
Dowling-Degos disease 1	DISCN7KL	Strong	Autosomal dominant	[5]
Endometrial carcinoma	DISXR5CY	Strong	Altered Expression	[6]
Epidermolysis bullosa	DISVOTZQ	Strong	Biomarker	[7]
Epidermolysis bullosa simplex 1B, generalized intermediate	DISI80OT	Strong	Autosomal dominant	[8]
Epidermolysis bullosa simplex 1C, localized	DISQCPMC	Strong	Autosomal dominant	[8]
Epidermolysis bullosa simplex 1D, generalized, intermediate or severe, autosomal recessive	DIS0EG3S	Strong	Autosomal recessive	[9]
Epidermolysis bullosa simplex 2B, generalized intermediate	DIS6SBME	Strong	Autosomal dominant	[10]
Epidermolysis bullosa simplex 2d, generalized, intermediate or severe, autosomal recessive	DISB6SS2	Strong	Autosomal recessive	[11]
Epidermolysis bullosa simplex 2F, with mottled pigmentation	DIS7VDBV	Strong	Autosomal dominant	[8]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[12]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[13]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[14]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[2]
Lung cancer	DISCM4YA	Strong	Biomarker	[15]
Lung carcinoma	DISTR26C	Strong	Biomarker	[16]
Mesothelioma	DISKWK9M	Strong	Biomarker	[17]
Osteoarthritis	DIS05URM	Strong	Genetic Variation	[18]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[12]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[12]
Skin disease	DISDW8R6	Strong	Genetic Variation	[19]
Skin neoplasm	DIS16DDV	Strong	Biomarker	[20]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[3]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[3]
Adrenocortical carcinoma	DISZF4HX	moderate	Biomarker	[21]
Carcinoma	DISH9F1N	moderate	Biomarker	[22]
High blood pressure	DISY2OHH	moderate	Biomarker	[23]
Dowling-Degos disease	DISGTTEP	Supportive	Autosomal dominant	[5]
Epidermolysis bullosa simplex 2E, with migratory circinate erythema	DIS4EGXJ	Supportive	Autosomal dominant	[24]
Rheumatoid arthritis	DISTSB4J	Disputed	Biomarker	[25]
Basal cell carcinoma	DIS7PYN3	Limited	Genetic Variation	[26]
Basal cell neoplasm	DIS37IXW	Limited	Genetic Variation	[26]
Breast neoplasm	DISNGJLM	Limited	Altered Expression	[27]
Colorectal carcinoma	DIS5PYL0	Limited	Biomarker	[28]
Coronary heart disease	DIS5OIP1	Limited	Biomarker	[29]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Biomarker	[30]
Non-small-cell lung cancer	DIS5Y6R9	Limited	Genetic Variation	[31]
Squamous cell carcinoma	DISQVIFL	Limited	Biomarker	[32]
Triple negative breast cancer	DISAMG6N	Limited	Altered Expression	[33]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[34]
Undifferentiated carcinoma	DISIAZST	Limited	Biomarker	[35]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Keratin, type II cytoskeletal 5 (KRT5).	[36]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Keratin, type II cytoskeletal 5 (KRT5).	[53]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[37]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[38]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[39]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[40]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[41]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[42]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[43]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[44]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[45]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[38]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[46]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[47]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol affects the expression of Keratin, type II cytoskeletal 5 (KRT5).	[48]
Alitretinoin	DMME8LH	Approved	Alitretinoin decreases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[38]
Imatinib	DM7RJXL	Approved	Imatinib increases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[49]
Bexarotene	DMOBIKY	Approved	Bexarotene decreases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[50]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[51]
Guaiacol	DMN4E7T	Phase 3	Guaiacol increases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[51]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[51]
PD-153035	DM7KJTI	Discontinued in Phase 1	PD-153035 decreases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[46]
SB-431542	DM0YOXQ	Preclinical	SB-431542 increases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[54]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[55]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[56]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	all-trans-4-oxo-retinoic acid decreases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[38]
Chlorogenic acid	DM2Y3P4	Investigative	Chlorogenic acid increases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[51]
TTNPB	DMSABD0	Investigative	TTNPB decreases the expression of Keratin, type II cytoskeletal 5 (KRT5).	[50]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
DNCB	DMDTVYC	Phase 2	DNCB affects the binding of Keratin, type II cytoskeletal 5 (KRT5).	[52]

References

• [1] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [2] Eight potential biomarkers for distinguishing between lung adenocarcinoma and squamous cell carcinoma.Oncotarget. 2017 May 3;8(42):71759-71771. doi: 10.18632/oncotarget.17606. eCollection 2017 Sep 22.
• [3] In stage pT1 non-muscle-invasive bladder cancer (NMIBC), high KRT20 and low KRT5 mRNA expression identify the luminal subtype and predict recurrence and survival.Virchows Arch. 2017 Mar;470(3):267-274. doi: 10.1007/s00428-017-2064-8. Epub 2017 Jan 10.
• [4] Association of Cytokeratin 5 and Claudin 3 expression with BRCA1 and BRCA2 germline mutations in women with early breast cancer.BMC Cancer. 2019 Jul 15;19(1):695. doi: 10.1186/s12885-019-5908-6.
• [5] Loss-of-function mutations in the keratin 5 gene lead to Dowling-Degos disease. Am J Hum Genet. 2006 Mar;78(3):510-9. doi: 10.1086/500850. Epub 2006 Jan 19.
• [6] Value of T cell receptor gamma alternate reading frame protein and keratin 5 in endometrial carcinoma.Chin Med J (Engl). 2013 Nov;126(22):4260-4.
• [7] The Role of Collagen IV and Cytokeratin 5/6 Immunohistochemistry in Identifying Subtypes of Hereditary Epidermolysis Bullosa.Appl Immunohistochem Mol Morphol. 2018 Sep;26(8):586-590. doi: 10.1097/PAI.0000000000000471.
• [8] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [9] PanelApp crowdsources expert knowledge to establish consensus diagnostic gene panels. Nat Genet. 2019 Nov;51(11):1560-1565. doi: 10.1038/s41588-019-0528-2.
• [10] Donor splice site mutation in keratin 5 causes in-frame removal of 22 amino acids of H1 and 1A rod domains in Dowling-Meara epidermolysis bullosa simplex. Eur J Hum Genet. 1999 Apr;7(3):293-300. doi: 10.1038/sj.ejhg.5200292.
• [11] Complete cytolysis and neonatal lethality in keratin 5 knockout mice reveal its fundamental role in skin integrity and in epidermolysis bullosa simplex. Mol Biol Cell. 2001 Jun;12(6):1775-89. doi: 10.1091/mbc.12.6.1775.
• [12] Keratin 5 overexpression is associated with serous ovarian cancer recurrence and chemotherapy resistance.Oncotarget. 2017 Mar 14;8(11):17819-17832. doi: 10.18632/oncotarget.14867.
• [13] Circulatory miR-98-5p levels are deregulated during diabetes and it inhibits proliferation and promotes apoptosis by targeting PPP1R15B in keratinocytes.RNA Biol. 2020 Feb;17(2):188-201. doi: 10.1080/15476286.2019.1673117. Epub 2019 Oct 15.
• [14] Establishment and characterization of a novel HPV-negative laryngeal squamous cell carcinoma cell line, FD-LSC-1, with missense and nonsense mutations of TP53 in the DNA-binding domain.Cancer Lett. 2014 Jan 1;342(1):92-103. doi: 10.1016/j.canlet.2013.08.041. Epub 2013 Aug 31.
• [15] Mucin staining is of limited value in addition to basic immunohistochemical analyses in the diagnostics of non-small cell lung cancer.Sci Rep. 2019 Feb 4;9(1):1319. doi: 10.1038/s41598-018-37722-0.
• [16] Isolation of cancer stem like cells from human adenosquamous carcinoma of the lung supports a monoclonal origin from a multipotential tissue stem cell.PLoS One. 2013 Dec 4;8(12):e79456. doi: 10.1371/journal.pone.0079456. eCollection 2013.
• [17] Cytokeratin 5/6 expression, prognosis, and association with estrogen receptor in high-grade serous ovarian carcinoma.Hum Pathol. 2017 Sep;67:30-36. doi: 10.1016/j.humpath.2017.03.020. Epub 2017 Apr 13.
• [18] Quantitative genetic study of amphiregulin and fractalkine circulating levels--potential markers of arthropathies.Osteoarthritis Cartilage. 2011 Jun;19(6):737-42. doi: 10.1016/j.joca.2011.02.013. Epub 2011 Feb 26.
• [19] An exvivo RNA trans-splicing strategy to correct human generalized severe epidermolysis bullosa simplex.Br J Dermatol. 2019 Jan;180(1):141-148. doi: 10.1111/bjd.17075. Epub 2018 Oct 7.
• [20] The human promyelocytic leukemia protein is a tumor suppressor for murine skin carcinogenesis.Mol Carcinog. 2009 Jul;48(7):599-609. doi: 10.1002/mc.20498.
• [21] Mitotane treatment in patients with metastatic testicular Leydig cell tumor associated with severe androgen excess.Eur J Endocrinol. 2018 Mar;178(3):K21-K27. doi: 10.1530/EJE-17-0542. Epub 2018 Jan 12.
• [22] Prognostic stratification of muscle invasive urothelial carcinomas using limited immunohistochemical panel of Gata3 and cytokeratins 5/6, 14 and 20.Ann Diagn Pathol. 2019 Dec;43:151397. doi: 10.1016/j.anndiagpath.2019.08.001. Epub 2019 Aug 3.
• [23] Prognostic Factors in Patients with an Implanted Pacemaker after 80 Years of Age in a 4-Year Follow-Up.Gerontology. 2018;64(2):107-117. doi: 10.1159/000481504. Epub 2017 Nov 15.
• [24] A usual frameshift and delayed termination codon mutation in keratin 5 causes a novel type of epidermolysis bullosa simplex with migratory circinate erythema. J Invest Dermatol. 2003 Sep;121(3):482-5. doi: 10.1046/j.1523-1747.2003.12424.x.
• [25] Cross talk between progesterone receptors and retinoic acid receptors in regulation of cytokeratin 5-positive breast cancer cells.Oncogene. 2017 Nov 2;36(44):6074-6084. doi: 10.1038/onc.2017.204. Epub 2017 Jul 10.
• [26] Combined analysis of keratinocyte cancers identifies novel genome-wide loci.Hum Mol Genet. 2019 Sep 15;28(18):3148-3160. doi: 10.1093/hmg/ddz121.
• [27] CD44 correlates with clinicopathological characteristics and is upregulated by EGFR in breast cancer.Int J Oncol. 2016 Oct;49(4):1343-50. doi: 10.3892/ijo.2016.3639. Epub 2016 Jul 29.
• [28] Immunohistochemical expression of p16, p53, and p63 in colorectal adenomas and adenocarcinomas.Dis Colon Rectum. 2006 May;49(5):588-94. doi: 10.1007/s10350-006-0515-4.
• [29] The effect of anti-rheumatic medications for coronary artery diseases risk in patients with rheumatoid arthritis might be changed over time: A nationwide population-based cohort study.PLoS One. 2017 Jun 28;12(6):e0179081. doi: 10.1371/journal.pone.0179081. eCollection 2017.
• [30] Proteomic Characterization Reveals a Molecular Portrait of Nasopharyngeal Carcinoma Differentiation.J Cancer. 2017 Feb 11;8(4):570-577. doi: 10.7150/jca.17414. eCollection 2017.
• [31] Loss of transforming growth factor beta type II receptor increases aggressive tumor behavior and reduces survival in lung adenocarcinoma and squamous cell carcinoma.Clin Cancer Res. 2012 Apr 15;18(8):2173-83. doi: 10.1158/1078-0432.CCR-11-2557. Epub 2012 Mar 7.
• [32] A combined gene expression tool for parallel histological prediction and gene fusion detection in non-small cell lung cancer.Sci Rep. 2019 Mar 26;9(1):5207. doi: 10.1038/s41598-019-41585-4.
• [33] Potential clinically useful prognostic biomarkers in triple-negative breast cancer: preliminary results of a retrospective analysis.Breast Cancer (Dove Med Press). 2018 Nov 23;10:177-194. doi: 10.2147/BCTT.S175556. eCollection 2018.
• [34] cells can be generated from cytokeratin 5-positive cells after cerulein-induced pancreatitis in adult mice.Biochem Biophys Res Commun. 2018 Jan 29;496(1):114-119. doi: 10.1016/j.bbrc.2018.01.008. Epub 2018 Jan 4.
• [35] cDNA microarray profiling of rat mammary gland carcinomas induced by 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine and 7,12-dimethylbenz[a]anthracene.Carcinogenesis. 2002 Oct;23(10):1561-8. doi: 10.1093/carcin/23.10.1561.
• [36] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [37] Evaluation of a human iPSC-derived BBB model for repeated dose toxicity testing with cyclosporine A as model compound. Toxicol In Vitro. 2021 Jun;73:105112. doi: 10.1016/j.tiv.2021.105112. Epub 2021 Feb 22.
• [38] Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
• [39] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [40] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [41] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [42] Inorganic arsenic promotes luminal to basal transition and metastasis of breast cancer. FASEB J. 2020 Dec;34(12):16034-16048. doi: 10.1096/fj.202001192R. Epub 2020 Oct 13.
• [43] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [44] Gene induction and apoptosis in human hepatocellular carci-noma cells SMMC-7721 exposed to 5-aza-2'-deoxycytidine. Chin Med J (Engl). 2007 Sep 20;120(18):1626-31.
• [45] Dissecting progressive stages of 5-fluorouracil resistance in vitro using RNA expression profiling. Int J Cancer. 2004 Nov 1;112(2):200-12. doi: 10.1002/ijc.20401.
• [46] Activation of PPAR and inhibition of cell proliferation reduces key proteins associated with the basal subtype of bladder cancer in As3+-transformed UROtsa cells. PLoS One. 2020 Aug 21;15(8):e0237976. doi: 10.1371/journal.pone.0237976. eCollection 2020.
• [47] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [48] The genomic response of Ishikawa cells to bisphenol A exposure is dose- and time-dependent. Toxicology. 2010 Apr 11;270(2-3):137-49. doi: 10.1016/j.tox.2010.02.008. Epub 2010 Feb 17.
• [49] Oral lichenoid eruption secondary to imatinib (Glivec). J Dermatolog Treat. 2004 Jul;15(4):253-5. doi: 10.1080/09546630410015556.
• [50] Retinoic acid receptor- and retinoid X receptor-selective retinoids activate signaling pathways that converge on AP-1 and inhibit squamous differentiation in human bronchial epithelial cells. Cell Growth Differ. 1996 Aug;7(8):997-1004.
• [51] Examining the genomic influence of skin antioxidants in vitro. Mediators Inflamm. 2010;2010.
• [52] Proteomic analysis of the cellular response to a potent sensitiser unveils the dynamics of haptenation in living cells. Toxicology. 2020 Dec 1;445:152603. doi: 10.1016/j.tox.2020.152603. Epub 2020 Sep 28.
• [53] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [54] Activin/nodal signaling switches the terminal fate of human embryonic stem cell-derived trophoblasts. J Biol Chem. 2015 Apr 3;290(14):8834-48.
• [55] Bisphenol A stimulates the epithelial mesenchymal transition of estrogen negative breast cancer cells via FOXA1 signals. Arch Biochem Biophys. 2015 Nov 1;585:10-16. doi: 10.1016/j.abb.2015.09.006. Epub 2015 Sep 9.
• [56] Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.