Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTX59D0X)

• DOT Name: Protein SCAF11 (SCAF11)
• Synonyms: CTD-associated SR protein 11; Renal carcinoma antigen NY-REN-40; SC35-interacting protein 1; SR-related and CTD-associated factor 11; SRSF2-interacting protein; Serine/arginine-rich splicing factor 2-interacting protein; Splicing factor, arginine/serine-rich 2-interacting protein; Splicing regulatory protein 129; SRrp129
• Gene Name: SCAF11
• Related Disease:
  Hirschsprung disease
  Mowat-Wilson syndrome
  Type-1 diabetes
  Advanced cancer
  Age-related macular degeneration
  Aplasia cutis congenita
  Behcet disease
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cervical cancer
  Cervical carcinoma
  Colon cancer
  Colon carcinoma
  Corpus callosum, agenesis of
  Endometrial cancer
  Endometrial carcinoma
  Epilepsy
  Gastric cancer
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Intrahepatic cholangiocarcinoma
  Malignant mesothelioma
  Metastatic malignant neoplasm
  Neoplasm
  Non-small-cell lung cancer
  Oral cancer
  Pancreatic cancer
  Pneumonia
  Pneumonitis
  Spinal muscular atrophy
  Squamous cell carcinoma
  Stomach cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Uveitis
  Vasculitis
  Carcinoma
  Coronary heart disease
  Epithelial ovarian cancer
  Marden-Walker syndrome
  Muckle-Wells syndrome
  Ovarian cancer
  Adrenocortical carcinoma
  Colitis
  Isolated congenital microcephaly
• UniProt ID: SCAFB_HUMAN
• Pfam ID: PF13639
• Sequence:
  MKKKTVCTLNMGDKKYEDMEGEENGDNTISTGLLYSEADRCPICLNCLLEKEVGFPESCN
  HVFCMTCILKWAETLASCPIDRKPFQAVFKFSALEGYVKVQVKKQLRETKDKKNENSFEK
  QVSCHENSKSCIRRKAIVREDLLSAKVCDLKWIHRNSLYSETGGKKNAAIKINKPQRSNW
  STNQCFRNFFSNMFSSVSHSGESSFTYRAYCTEFIEASEISALIRQKRHELELSWFPDTL
  PGIGRIGFIPWNVETEVLPLISSVLPRTIFPTSTISFEHFGTSCKGYALAHTQEGEEKKQ
  TSGTSNTRGSRRKPAMTTPTRRSTRNTRAETASQSQRSPISDNSGCDAPGNSNPSLSVPS
  SAESEKQTRQAPKRKSVRRGRKPPLLKKKLRSSVAAPEKSSSNDSVDEETAESDTSPVLE
  KEHQPDVDSSNICTVQTHVENQSANCLKSCNEQIEESEKHTANYDTEERVGSSSSESCAQ
  DLPVLVGEEGEVKKLENTGIEANVLCLESEISENILEKGGDPLEKQDQISGLSQSEVKTD
  VCTVHLPNDFPTCLTSESKVYQPVSCPLSDLSENVESVVNEEKITESSLVEITEHKDFTL
  KTEELIESPKLESSEGEIIQTVDRQSVKSPEVQLLGHVETEDVEIIATCDTFGNEDFNNI
  QDSENNLLKNNLLNTKLEKSLEEKNESLTEHPRSTELPKTHIEQIQKHFSEDNNEMIPME
  CDSFCSDQNESEVEPSVNADLKQMNENSVTHCSENNMPSSDLADEKVETVSQPSESPKDT
  IDKTKKPRTRRSRFHSPSTTWSPNKDTPQEKKRPQSPSPRRETGKESRKSQSPSPKNESA
  RGRKKSRSQSPKKDIARERRQSQSRSPKRDTTRESRRSESLSPRRETSRENKRSQPRVKD
  SSPGEKSRSQSRERESDRDGQRRERERRTRKWSRSRSHSRSPSRCRTKSKSSSFGRIDRD
  SYSPRWKGRWANDGWRCPRGNDRYRKNDPEKQNENTRKEKNDIHLDADDPNSADKHRNDC
  PNWITEKINSGPDPRTRNPEKLKESHWEENRNENSGNSWNKNFGSGWVSNRGRGRGNRGR
  GTYRSSFAYKDQNENRWQNRKPLSGNSNSSGSESFKFVEQQSYKRKSEQEFSFDTPADRS
  GWTSASSWAVRKTLPADVQNYYSRRGRNSSGPQSGWMKQEEETSGQDSSLKDQTNQQVDG
  SQLPINMMQPQMNVMQQQMNAQHQPMNIFPYPVGVHAPLMNIQRNPFNIHPQLPLHLHTG
  VPLMQVATPTSVSQGLPPPPPPPPPSQQVNYIASQPDGKQLQGIPSSSHVSNNMSTPVLP
  APTAAPGNTGMVQGPSSGNTSSSSHSKASNAAVKLAESKVSVAVEASADSSKTDKKLQIQ
  EKAAQEVKLAIKPFYQNKDITKEEYKEIVRKAVDKVCHSKSGEVNSTKVANLVKAYVDKY
  KYSRKGSQKKTLEEPVSTEKNIG
• Function: Plays a role in pre-mRNA alternative splicing by regulating spliceosome assembly.
• Tissue Specificity: Widely expressed.

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hirschsprung disease	DISUUSM1	Definitive	Biomarker	[1]
Mowat-Wilson syndrome	DISD1AW7	Definitive	Genetic Variation	[2]
Type-1 diabetes	DIS7HLUB	Definitive	Biomarker	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Age-related macular degeneration	DIS0XS2C	Strong	Altered Expression	[5]
Aplasia cutis congenita	DISMDAYM	Strong	Altered Expression	[6]
Behcet disease	DISSYMBS	Strong	Altered Expression	[7]
Bladder cancer	DISUHNM0	Strong	Biomarker	[8]
Breast cancer	DIS7DPX1	Strong	Biomarker	[9]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[9]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[9]
Cervical cancer	DISFSHPF	Strong	Biomarker	[10]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[10]
Colon cancer	DISVC52G	Strong	Biomarker	[11]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[11]
Corpus callosum, agenesis of	DISO9P40	Strong	Altered Expression	[6]
Endometrial cancer	DISW0LMR	Strong	Altered Expression	[12]
Endometrial carcinoma	DISXR5CY	Strong	Altered Expression	[12]
Epilepsy	DISBB28L	Strong	Genetic Variation	[13]
Gastric cancer	DISXGOUK	Strong	Biomarker	[4]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[15]
Intrahepatic cholangiocarcinoma	DIS6GOC8	Strong	Altered Expression	[16]
Malignant mesothelioma	DISTHJGH	Strong	Biomarker	[17]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[18]
Neoplasm	DISZKGEW	Strong	Altered Expression	[19]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[20]
Oral cancer	DISLD42D	Strong	Altered Expression	[21]
Pancreatic cancer	DISJC981	Strong	Altered Expression	[22]
Pneumonia	DIS8EF3M	Strong	Biomarker	[23]
Pneumonitis	DIS88E0K	Strong	Biomarker	[23]
Spinal muscular atrophy	DISTLKOB	Strong	Biomarker	[24]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[25]
Stomach cancer	DISKIJSX	Strong	Biomarker	[4]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[8]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[8]
Uveitis	DISV0RYS	Strong	Biomarker	[7]
Vasculitis	DISQRKDX	Strong	Biomarker	[7]
Carcinoma	DISH9F1N	moderate	Altered Expression	[26]
Coronary heart disease	DIS5OIP1	moderate	Genetic Variation	[27]
Epithelial ovarian cancer	DIS56MH2	moderate	Biomarker	[28]
Marden-Walker syndrome	DISUAMD9	moderate	Genetic Variation	[29]
Muckle-Wells syndrome	DISMT3TQ	moderate	Genetic Variation	[29]
Ovarian cancer	DISZJHAP	moderate	Biomarker	[28]
Adrenocortical carcinoma	DISZF4HX	Limited	Biomarker	[30]
Colitis	DISAF7DD	Limited	Biomarker	[31]
Isolated congenital microcephaly	DISUXHZ6	Limited	Genetic Variation	[32]

17 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein SCAF11 (SCAF11).	[33]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Protein SCAF11 (SCAF11).	[34]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Protein SCAF11 (SCAF11).	[35]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Protein SCAF11 (SCAF11).	[36]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Protein SCAF11 (SCAF11).	[37]
Marinol	DM70IK5	Approved	Marinol increases the expression of Protein SCAF11 (SCAF11).	[39]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Protein SCAF11 (SCAF11).	[40]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Protein SCAF11 (SCAF11).	[41]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Protein SCAF11 (SCAF11).	[42]
Clorgyline	DMCEUJD	Approved	Clorgyline increases the expression of Protein SCAF11 (SCAF11).	[43]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Protein SCAF11 (SCAF11).	[44]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Protein SCAF11 (SCAF11).	[45]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Protein SCAF11 (SCAF11).	[47]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Protein SCAF11 (SCAF11).	[48]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Protein SCAF11 (SCAF11).	[49]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Protein SCAF11 (SCAF11).	[40]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Protein SCAF11 (SCAF11).	[50]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin increases the phosphorylation of Protein SCAF11 (SCAF11).	[38]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Protein SCAF11 (SCAF11).	[46]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Protein SCAF11 (SCAF11).	[38]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Protein SCAF11 (SCAF11).	[38]

References

• [1] Mutations in Smad-interacting protein 1 gene are responsible for absence of its expression in Hirschsprung's disease.Clin Exp Med. 2018 Aug;18(3):445-451. doi: 10.1007/s10238-018-0496-3. Epub 2018 Mar 29.
• [2] Role of Zeb2/Sip1 in neuronal development.Brain Res. 2019 Feb 15;1705:24-31. doi: 10.1016/j.brainres.2018.09.034. Epub 2018 Sep 25.
• [3] Comparative analysis of gene expression profiles in children with type 1 diabetes mellitus.Mol Med Rep. 2019 May;19(5):3989-4000. doi: 10.3892/mmr.2019.10099. Epub 2019 Mar 28.
• [4] Knockdown of ARK5 Expression Suppresses Invasion and Metastasis of Gastric Cancer.Cell Physiol Biochem. 2017;42(3):1025-1036. doi: 10.1159/000478685. Epub 2017 Jun 28.
• [5] Transcriptional factors associated with epithelial-mesenchymal transition in choroidal neovascularization.Mol Vis. 2011;17:1222-30. Epub 2011 May 6.
• [6] Is there a role for epithelial-mesenchymal transition in adrenocortical tumors?.Endocrine. 2017 Nov;58(2):276-288. doi: 10.1007/s12020-017-1409-z. Epub 2017 Sep 8.
• [7] Identification and characterization of the carboxy-terminal region of Sip-1, a novel autoantigen in Behet's disease.Arthritis Res Ther. 2006;8(3):R71. doi: 10.1186/ar1940. Epub 2006 Apr 12.
• [8] SIP1 protein protects cells from DNA damage-induced apoptosis and has independent prognostic value in bladder cancer.Proc Natl Acad Sci U S A. 2009 Sep 1;106(35):14884-9. doi: 10.1073/pnas.0902042106. Epub 2009 Aug 17.
• [9] Regulation of vimentin by SIP1 in human epithelial breast tumor cells.Oncogene. 2006 Aug 17;25(36):4975-85. doi: 10.1038/sj.onc.1209511. Epub 2006 Mar 27.
• [10] Long non-coding RNA NORAD upregulate SIP1 expression to promote cell proliferation and invasion in cervical cancer.Biomed Pharmacother. 2018 Oct;106:1454-1460. doi: 10.1016/j.biopha.2018.07.101. Epub 2018 Jul 24.
• [11] Neoexpression of N-cadherin in E-cadherin positive colon cancers.Int J Cancer. 2004 Sep 20;111(5):711-9. doi: 10.1002/ijc.20317.
• [12] The role of hepatocyte growth factor activator inhibitor (HAI)-1 and HAI-2 in endometrial cancer.Int J Cancer. 2011 Jun 1;128(11):2613-24. doi: 10.1002/ijc.25606. Epub 2010 Oct 4.
• [13] Sip-1 mutations cause disturbances in the activity of NMDA- and AMPA-, but not kainate receptors of neurons in the cerebral cortex.Neurosci Lett. 2017 May 22;650:180-186. doi: 10.1016/j.neulet.2017.04.048. Epub 2017 Apr 25.
• [14] Restoration of E-cadherin expression by selective Cox-2 inhibition and the clinical relevance of the epithelial-to-mesenchymal transition in head and neck squamous cell carcinoma.J Exp Clin Cancer Res. 2014 May 10;33(1):40. doi: 10.1186/1756-9966-33-40.
• [15] SIP1 is downregulated in hepatocellular carcinoma by promoter hypermethylation.BMC Cancer. 2011 Jun 6;11:223. doi: 10.1186/1471-2407-11-223.
• [16] MiR-590-3p suppresses epithelial-mesenchymal transition in intrahepatic cholangiocarcinoma by inhibiting SIP1 expression.Oncotarget. 2017 May 23;8(21):34698-34708. doi: 10.18632/oncotarget.16150.
• [17] Expression of Snail, Slug and Sip1 in malignant mesothelioma effusions is associated with matrix metalloproteinase, but not with cadherin expression.Lung Cancer. 2006 Dec;54(3):309-17. doi: 10.1016/j.lungcan.2006.08.010. Epub 2006 Sep 25.
• [18] The miR-200 family and miR-205 regulate epithelial to mesenchymal transition by targeting ZEB1 and SIP1.Nat Cell Biol. 2008 May;10(5):593-601. doi: 10.1038/ncb1722. Epub 2008 Mar 30.
• [19] Expression of TWIST1, Snail, Slug, and NF-B and methylation of the TWIST1 promoter in mammary phyllodes tumor.Tumour Biol. 2013 Feb;34(1):445-53. doi: 10.1007/s13277-012-0569-y. Epub 2012 Nov 14.
• [20] Knockdown of ZEB1, a master epithelial-to-mesenchymal transition (EMT) gene, suppresses anchorage-independent cell growth of lung cancer cells.Cancer Lett. 2010 Oct 28;296(2):216-24. doi: 10.1016/j.canlet.2010.04.008. Epub 2010 May 7.
• [21] Epigenetic inactivation of E-cadherin by promoter hypermethylation in oral carcinoma cells.Odontology. 2007 Jul;95(1):24-9. doi: 10.1007/s10266-007-0068-6. Epub 2007 Jul 25.
• [22] Pancreatic cancers epigenetically silence SIP1 and hypomethylate and overexpress miR-200a/200b in association with elevated circulating miR-200a and miR-200b levels.Cancer Res. 2010 Jul 1;70(13):5226-37. doi: 10.1158/0008-5472.CAN-09-4227. Epub 2010 Jun 15.
• [23] NLRC4 and TLR5 each contribute to host defense in respiratory melioidosis.PLoS Negl Trop Dis. 2014 Sep 18;8(9):e3178. doi: 10.1371/journal.pntd.0003178. eCollection 2014 Sep.
• [24] Co-regulation of survival of motor neuron (SMN) protein and its interactor SIP1 during development and in spinal muscular atrophy.Hum Mol Genet. 2001 Mar 1;10(5):497-505. doi: 10.1093/hmg/10.5.497.
• [25] Transcription factors Snail, Slug, Twist, and SIP1 in spindle cell carcinoma of the head and neck.Virchows Arch. 2009 May;454(5):549-55. doi: 10.1007/s00428-009-0771-5. Epub 2009 Apr 21.
• [26] Slug is overexpressed in gastric carcinomas and may act synergistically with SIP1 and Snail in the down-regulation of E-cadherin.J Pathol. 2007 Apr;211(5):507-515. doi: 10.1002/path.2138.
• [27] Identification of 64 Novel Genetic Loci Provides an Expanded View on the Genetic Architecture of Coronary Artery Disease.Circ Res. 2018 Feb 2;122(3):433-443. doi: 10.1161/CIRCRESAHA.117.312086. Epub 2017 Dec 6.
• [28] Changes in the expression of E-cadherin repressors, Snail, Slug, SIP1, and Twist, in the development and progression of ovarian carcinoma: the important role of Snail in ovarian tumorigenesis and progression.Med Mol Morphol. 2009 Jun;42(2):82-91. doi: 10.1007/s00795-008-0436-5. Epub 2009 Jun 18.
• [29] Clinical features and management issues in Mowat-Wilson syndrome.Am J Med Genet A. 2006 Dec 15;140(24):2730-41. doi: 10.1002/ajmg.a.31530.
• [30] A Novel TP53 Mutation Associated with TWIST1 and SIP1 Expression in an Aggressive Adrenocortical Carcinoma.Endocr Pathol. 2017 Dec;28(4):326-331. doi: 10.1007/s12022-017-9482-7.
• [31] Environmental Factors Modify the Severity of Acute DSS Colitis in Caspase-11-Deficient Mice.Inflamm Bowel Dis. 2018 Oct 12;24(11):2394-2403. doi: 10.1093/ibd/izy244.
• [32] Further delineation of the phenotype associated with heterozygous mutations in ZFHX1B.Am J Med Genet A. 2003 Jun 15;119A(3):257-65. doi: 10.1002/ajmg.a.20053.
• [33] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [34] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [35] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [36] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [37] Estradiol and selective estrogen receptor modulators differentially regulate target genes with estrogen receptors alpha and beta. Mol Biol Cell. 2004 Mar;15(3):1262-72. doi: 10.1091/mbc.e03-06-0360. Epub 2003 Dec 29.
• [38] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [39] Delta9-tetrahydrocannabinol inhibits cytotrophoblast cell proliferation and modulates gene transcription. Mol Hum Reprod. 2006 May;12(5):321-33. doi: 10.1093/molehr/gal036. Epub 2006 Apr 5.
• [40] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [41] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [42] Nicotinic modulation of gene expression in SH-SY5Y neuroblastoma cells. Brain Res. 2006 Oct 20;1116(1):39-49.
• [43] Anti-oncogenic and pro-differentiation effects of clorgyline, a monoamine oxidase A inhibitor, on high grade prostate cancer cells. BMC Med Genomics. 2009 Aug 20;2:55. doi: 10.1186/1755-8794-2-55.
• [44] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [45] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [46] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [47] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [48] Characterization of the Molecular Alterations Induced by the Prolonged Exposure of Normal Colon Mucosa and Colon Cancer Cells to Low-Dose Bisphenol A. Int J Mol Sci. 2022 Oct 1;23(19):11620. doi: 10.3390/ijms231911620.
• [49] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [50] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.