Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYYZGLH)

• DOT Name: Sal-like protein 1 (SALL1)
• Synonyms: Spalt-like transcription factor 1; Zinc finger protein 794; Zinc finger protein SALL1; Zinc finger protein Spalt-1; HSal1; Sal-1
• Gene Name: SALL1
• Related Disease:
  Advanced cancer
  Nephropathy
  Parkinson disease
  Townes-Brocks syndrome 1
  Acute myelogenous leukaemia
  Becker muscular dystrophy
  Branchio-oto-renal syndrome
  Breast cancer
  Breast carcinoma
  Carcinoma
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Craniofacial microsomia
  Duane retraction syndrome
  Glomerulosclerosis
  Hepatitis B virus infection
  Herpes simplex infection
  Kidney failure
  Leiomyoma
  Multiple sclerosis
  Neoplasm
  Nephrotic syndrome
  Prostate cancer
  Prostate carcinoma
  Renal dysplasia
  Staphylococcus aureus infection
  Trophoblastic neoplasm
  Type-1/2 diabetes
  Uterine fibroids
  Vitelliform macular dystrophy
  Congenital deformities of limbs
  Ear malformation
  Small lymphocytic lymphoma
  Townes-Brocks syndrome
  Intellectual disability
  Childhood kidney Wilms tumor
  Glaucoma/ocular hypertension
  Osteoporosis
  Tuberculosis
  Wilms tumor
• UniProt ID: SALL1_HUMAN
• Pfam ID: PF00096 ; PF12874
• Sequence:
  MSRRKQAKPQHFQSDPEVASLPRRDGDTEKGQPSRPTKSKDAHVCGRCCAEFFELSDLLL
  HKKNCTKNQLVLIVNENPASPPETFSPSPPPDNPDEQMNDTVNKTDQVDCSDLSEHNGLD
  REESMEVEAPVANKSGSGTSSGSHSSTAPSSSSSSSSSSGGGGSSSTGTSAITTSLPQLG
  DLTTLGNFSVINSNVIIENLQSTKVAVAQFSQEARCGGASGGKLAVPALMEQLLALQQQQ
  IHQLQLIEQIRHQILLLASQNADLPTSSSPSQGTLRTSANPLSTLSSHLSQQLAAAAGLA
  QSLASQSASISGVKQLPPIQLPQSSSGNTIIPSNSGSSPNMNILAAAVTTPSSEKVASSA
  GASHVSNPAVSSSSSPAFAISSLLSPASNPLLPQQASANSVFPSPLPNIGTTAEDLNSLS
  ALAQQRKSKPPNVTAFEAKSTSDEAFFKHKCRFCAKVFGSDSALQIHLRSHTGERPFKCN
  ICGNRFSTKGNLKVHFQRHKEKYPHIQMNPYPVPEHLDNIPTSTGIPYGMSIPPEKPVTS
  WLDTKPVLPTLTTSVGLPLPPTLPSLIPFIKTEEPAPIPISHSATSPPGSVKSDSGGPES
  ATRNLGGLPEEAEGSTLPPSGGKSEESGMVTNSVPTASSSVLSSPAADCGPAGSATTFTN
  PLLPLMSEQFKAKFPFGGLLDSAQASETSKLQQLVENIDKKATDPNECIICHRVLSCQSA
  LKMHYRTHTGERPFKCKICGRAFTTKGNLKTHYSVHRAMPPLRVQHSCPICQKKFTNAVV
  LQQHIRMHMGGQIPNTPVPDSYSESMESDTGSFDEKNFDDLDNFSDENMEDCPEGSIPDT
  PKSADASQDSLSSSPLPLEMSSIAALENQMKMINAGLAEQLQASLKSVENGSIEGDVLTN
  DSSSVGGDMESQSAGSPAISESTSSMQALSPSNSTQEFHKSPSIEEKPQRAVPSEFANGL
  SPTPVNGGALDLTSSHAEKIIKEDSLGILFPFRDRGKFKNTACDICGKTFACQSALDIHY
  RSHTKERPFICTVCNRGFSTKGNLKQHMLTHQMRDLPSQLFEPSSNLGPNQNSAVIPANS
  LSSLIKTEVNGFVHVSPQDSKDTPTSHVPSGPLSSSATSPVLLPALPRRTPKQHYCNTCG
  KTFSSSSALQIHERTHTGEKPFACTICGRAFTTKGNLKVHMGTHMWNSTPARRGRRLSVD
  GPMTFLGGNPVKFPEMFQKDLAARSGSGDPSSFWNQYAAALSNGLAMKANEISVIQNGGI
  PPIPGSLGSGNSSPVSGLTGNLERLQNSEPNAPLAGLEKMASSENGTNFRFTRFVEDSKE
  IVTS
• Function: Transcriptional repressor involved in organogenesis. Plays an essential role in ureteric bud invasion during kidney development.
• Tissue Specificity: Highest levels in kidney. Lower levels in adult brain (enriched in corpus callosum, lower expression in substantia nigra) and liver.
• Reactome Pathway: POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation (R-HSA-2892247)

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Definitive	Biomarker	[1]
Nephropathy	DISXWP4P	Definitive	Genetic Variation	[2]
Parkinson disease	DISQVHKL	Definitive	Biomarker	[3]
Townes-Brocks syndrome 1	DISCOMHU	Definitive	Autosomal dominant	[4]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[5]
Becker muscular dystrophy	DIS5IYHL	Strong	Biomarker	[6]
Branchio-oto-renal syndrome	DISIPQ53	Strong	Biomarker	[7]
Breast cancer	DIS7DPX1	Strong	Biomarker	[1]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[1]
Carcinoma	DISH9F1N	Strong	Posttranslational Modification	[8]
Colon cancer	DISVC52G	Strong	Biomarker	[9]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[9]
Colorectal carcinoma	DIS5PYL0	Strong	Posttranslational Modification	[8]
Craniofacial microsomia	DISYHJ2P	Strong	Genetic Variation	[10]
Duane retraction syndrome	DISOEBK2	Strong	Genetic Variation	[11]
Glomerulosclerosis	DISJF20Z	Strong	Altered Expression	[12]
Hepatitis B virus infection	DISLQ2XY	Strong	Altered Expression	[13]
Herpes simplex infection	DISL1SAV	Strong	Biomarker	[14]
Kidney failure	DISOVQ9P	Strong	Genetic Variation	[15]
Leiomyoma	DISLDDFN	Strong	Altered Expression	[16]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[17]
Neoplasm	DISZKGEW	Strong	Biomarker	[1]
Nephrotic syndrome	DISSPSC2	Strong	Altered Expression	[12]
Prostate cancer	DISF190Y	Strong	Biomarker	[18]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[18]
Renal dysplasia	DIS3DFGD	Strong	Biomarker	[19]
Staphylococcus aureus infection	DISK6PTH	Strong	Biomarker	[20]
Trophoblastic neoplasm	DISY8WKT	Strong	Altered Expression	[21]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[22]
Uterine fibroids	DISBZRMJ	Strong	Altered Expression	[16]
Vitelliform macular dystrophy	DISEFYYN	Strong	Biomarker	[6]
Congenital deformities of limbs	DISP4N1Q	moderate	Genetic Variation	[23]
Ear malformation	DISVJGPS	moderate	Genetic Variation	[10]
Small lymphocytic lymphoma	DIS30POX	moderate	Biomarker	[24]
Townes-Brocks syndrome	DISDR57E	Supportive	Autosomal dominant	[25]
Intellectual disability	DISMBNXP	Disputed	Genetic Variation	[26]
Childhood kidney Wilms tumor	DIS0NMK3	Limited	Altered Expression	[27]
Glaucoma/ocular hypertension	DISLBXBY	Limited	Biomarker	[28]
Osteoporosis	DISF2JE0	Limited	Biomarker	[29]
Tuberculosis	DIS2YIMD	Limited	Biomarker	[30]
Wilms tumor	DISB6T16	Limited	Altered Expression	[27]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cyclophosphamide	DM4O2Z7	Approved	Sal-like protein 1 (SALL1) affects the response to substance of Cyclophosphamide.	[48]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Sal-like protein 1 (SALL1).	[31]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Sal-like protein 1 (SALL1).	[32]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Sal-like protein 1 (SALL1).	[33]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Sal-like protein 1 (SALL1).	[34]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Sal-like protein 1 (SALL1).	[35]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Sal-like protein 1 (SALL1).	[36]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Sal-like protein 1 (SALL1).	[37]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Sal-like protein 1 (SALL1).	[38]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Sal-like protein 1 (SALL1).	[39]
Marinol	DM70IK5	Approved	Marinol increases the expression of Sal-like protein 1 (SALL1).	[40]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Sal-like protein 1 (SALL1).	[41]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Sal-like protein 1 (SALL1).	[42]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Sal-like protein 1 (SALL1).	[43]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Sal-like protein 1 (SALL1).	[35]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Sal-like protein 1 (SALL1).	[47]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Sal-like protein 1 (SALL1).	[39]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Sal-like protein 1 (SALL1).	[44]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Sal-like protein 1 (SALL1).	[45]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Sal-like protein 1 (SALL1).	[46]

References

• [1] SALL1 functions as a tumor suppressor in breast cancer by regulating cancer cell senescence and metastasis through the NuRD complex.Mol Cancer. 2018 Apr 6;17(1):78. doi: 10.1186/s12943-018-0824-y.
• [2] Nephropathy in Townes-Brocks syndrome (SALL1 mutation): imaging and pathological findings in adulthood.Nephrol Dial Transplant. 2009 Apr;24(4):1341-5. doi: 10.1093/ndt/gfp014. Epub 2009 Feb 9.
• [3] The lysosomal membrane protein LAMP2A promotes autophagic flux and prevents SNCA-induced Parkinson disease-like symptoms in the Drosophila brain.Autophagy. 2018;14(11):1898-1910. doi: 10.1080/15548627.2018.1491489. Epub 2018 Aug 10.
• [4] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [5] SALL1 expression in acute myeloid leukemia.Oncotarget. 2017 Dec 15;9(7):7442-7452. doi: 10.18632/oncotarget.23448. eCollection 2018 Jan 26.
• [6] The lumbar spine age-related degenerative disease influences the BMD not the TBS: the Osteolaus cohort.Osteoporos Int. 2017 Mar;28(3):909-915. doi: 10.1007/s00198-016-3829-7. Epub 2016 Nov 30.
• [7] Prevalence of mutations in renal developmental genes in children with renal hypodysplasia: results of the ESCAPE study. J Am Soc Nephrol. 2006 Oct;17(10):2864-70. doi: 10.1681/ASN.2006030277. Epub 2006 Sep 13.
• [8] miR-181a-2* expression is different amongst carcinomas from the colorectal serrated route.Mutagenesis. 2020 Jul 11;35(3):233-241. doi: 10.1093/mutage/gez039.
• [9] The identification of specific methylation patterns across different cancers.PLoS One. 2015 Mar 16;10(3):e0120361. doi: 10.1371/journal.pone.0120361. eCollection 2015.
• [10] Wide phenotypic variations within a family with SALL1 mutations: Isolated external ear abnormalities to Goldenhar syndrome.Am J Med Genet A. 2007 May 15;143A(10):1087-90. doi: 10.1002/ajmg.a.31700.
• [11] The association of an epibulbar dermoid and Duane syndrome in a patient with a SALL1 mutation (Townes-Brocks Syndrome).Ophthalmic Genet. 2008 Dec;29(4):177-80. doi: 10.1080/13816810802354224.
• [12] Re-expression of Sall1 in podocytes protects against adriamycin-induced nephrosis.Lab Invest. 2017 Nov;97(11):1306-1320. doi: 10.1038/labinvest.2017.69. Epub 2017 Jul 31.
• [13] An improved experimental model for studying vertical transmission of hepatitis B virus via human spermatozoa.J Virol Methods. 2008 Jul;151(1):116-20. doi: 10.1016/j.jviromet.2008.03.014. Epub 2008 Apr 23.
• [14] Subtypes of herpes simplex virus type 1 in Japan: classification by restriction endonucleases and analysis of distribution.J Infect Dis. 1985 Jul;152(1):190-7. doi: 10.1093/infdis/152.1.190.
• [15] Kidney failure in Townes-Brocks syndrome: an under recognized phenomenon?.Am J Med Genet A. 2007 Nov 1;143A(21):2588-91. doi: 10.1002/ajmg.a.31699.
• [16] The effect of estrogen and androgen on androgen receptors and mRNA levels in uterine leiomyoma, myometrium and endometrium of human subjects.J Steroid Biochem Mol Biol. 1994 Aug;50(3-4):137-43. doi: 10.1016/0960-0760(94)90020-5.
• [17] Cortical M1 plasticity and metaplasticity in patients with multiple sclerosis.Mult Scler Relat Disord. 2020 Feb;38:101494. doi: 10.1016/j.msard.2019.101494. Epub 2019 Nov 5.
• [18] miR-4286 promotes prostate cancer progression by targeting the expression of SALL1.J Gene Med. 2023 Jul;25(7):e3127. doi: 10.1002/jgm.3127. Epub 2023 May 30.
• [19] Expression profiles of congenital renal dysplasia reveal new insights into renal development and disease.Pediatr Nephrol. 2007 Jul;22(7):962-74. doi: 10.1007/s00467-007-0466-6. Epub 2007 Apr 21.
• [20] Antibacterial properties of a pre-formulated recombinant phage endolysin, SAL-1.Int J Antimicrob Agents. 2013 Feb;41(2):156-61. doi: 10.1016/j.ijantimicag.2012.10.011. Epub 2012 Dec 28.
• [21] SALL1 expression in the human pituitary-adrenal/gonadal axis.J Endocrinol. 2002 Jun;173(3):437-48. doi: 10.1677/joe.0.1730437.
• [22] Trabecular bone quality is lower in adults with type 1 diabetes and is negatively associated with insulin resistance.Osteoporos Int. 2018 Mar;29(3):733-739. doi: 10.1007/s00198-017-4353-0. Epub 2017 Dec 30.
• [23] Nonsense-mediated decay and the molecular pathogenesis of mutations in SALL1 and GLI3.Am J Med Genet A. 2007 Dec 15;143A(24):3150-60. doi: 10.1002/ajmg.a.32097.
• [24] Genome-wide DNA methylation profiling of chronic lymphocytic leukemia allows identification of epigenetically repressed molecular pathways with clinical impact.Epigenetics. 2010 Aug 16;5(6):499-508. doi: 10.4161/epi.5.6.12179. Epub 2010 Aug 16.
• [25] Townes-Brocks Syndrome. 2007 Jan 24 [updated 2016 Jan 14]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
• [26] Homozygous SALL1 mutation causes a novel multiple congenital anomaly-mental retardation syndrome.J Pediatr. 2013 Mar;162(3):612-7. doi: 10.1016/j.jpeds.2012.08.042. Epub 2012 Oct 12.
• [27] Hsal 1 is related to kidney and gonad development and is expressed in Wilms tumor.Pediatr Nephrol. 2001 Sep;16(9):701-9. doi: 10.1007/s004670100624.
• [28] Common genetic variants associated with open-angle glaucoma.Hum Mol Genet. 2011 Jun 15;20(12):2464-71. doi: 10.1093/hmg/ddr120. Epub 2011 Mar 22.
• [29] Trabecular bone score and bone mineral density reference data for women aged 20-70years and the effect of local reference data on the prevalence of postmenopausal osteoporosis: a cross-sectional study from Sri Lanka.Arch Osteoporos. 2019 Aug 20;14(1):91. doi: 10.1007/s11657-019-0640-z.
• [30] The detection of Mycobacterium tuberculosis in uncultured clinical specimens using the polymerase chain reaction and a non-radioactive DNA probe.Mol Cell Probes. 1992 Jun;6(3):181-91. doi: 10.1016/0890-8508(92)90015-p.
• [31] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [32] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [33] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [34] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [35] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [36] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [37] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [38] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [39] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [40] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [41] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [42] Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
• [43] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [44] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [45] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [46] Genome-wide alteration in DNA hydroxymethylation in the sperm from bisphenol A-exposed men. PLoS One. 2017 Jun 5;12(6):e0178535. doi: 10.1371/journal.pone.0178535. eCollection 2017.
• [47] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [48] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.