Details of the Drug

General Information of Drug (ID: DMJO6GV)

• Drug Name: Abciximab
• Synonyms: ReoPro (TN)

Indication

Disease Entry	ICD 11	Status	REF
Acute disease	N.A.	Approved	[1]
Angina pectoris	BA40	Approved	[2]
Brain ischaemia	8B1Z	Approved	[3]

• Therapeutic Class: Anticoagulants
• Drug Type: Monoclonal antibody
• Sequence:
  >heavy chain 1
  EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKY
  DPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSA
  KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
  YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG
  PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
  STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
  LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
  QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
  >light chain 1
  DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPS
  RFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPP
  SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
  LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
  >heavy chain 2
  EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKY
  DPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSA
  KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
  YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG
  PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
  STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
  LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
  QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
  >light chain 2
  DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPS
  RFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPP
  SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
  LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
• ADMET Property:
  Half-life: The concentration or amount of drug in body reduced by one-half in less than 10 minutes [4]
  Metabolism: The drug is metabolized via opsonization via the reticuloendothelial system []

Adverse Drug Reaction (ADR)

ADR Term	Variation	Related DOT	DOT ID	REF
Surgical and medical procedures	Not Available	ITGA2B	OT4Y17PY	[5]
Surgical and medical procedures	Not Available	ITGB3	OTWCK1K6	[5]

• Cross-matching ID:
  DrugBank ID: DB00054
  TTD ID: D0P3TX
• Repurposed Drugs (RPD): Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Glycoprotein IIb/IIIa receptor (GPIIb/IIIa)	TT38RM1	ITA2B_HUMAN ; ITB3_HUMAN	Modulator	[6]

Drug Off-Target (DOT)

DOT Name	DOT ID	UniProt ID	Interaction	REF
Integrin alpha-IIb (ITGA2B)	OT4Y17PY	ITA2B_HUMAN	Drug Response	[5]
Integrin beta-3 (ITGB3)	OTWCK1K6	ITB3_HUMAN	Drug Response	[5]

Molecular Expression Atlas of This Drug

• The Studied Disease: Acute disease

Molecule Name	Molecule Type	Gene Name	p-value	Fold-Change	Z-score
Glycoprotein IIb/IIIa receptor (GPIIb/IIIa)	DTT	ITGA2B; ITGB3	7.83E-01	-0.11	-0.45

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Abciximab (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Vitamin E	DMZC90K	Moderate	Increased risk of bleeding by the combination of Abciximab and Vitamin E.	Cardiovascular disease [BA00-BE2Z]	[7]
Drotrecogin alfa	DM59JCN	Major	Increased risk of bleeding by the combination of Abciximab and Drotrecogin alfa.	Cerebral ischaemia [8B1Z]	[8]
Pentosan polysulfate	DM2HRKE	Moderate	Increased risk of bleeding by the combination of Abciximab and Pentosan polysulfate.	Chronic pain [MG30]	[9]
Phenylbutazone	DMAYL0T	Moderate	Increased risk of bleeding by the combination of Abciximab and Phenylbutazone.	Chronic pain [MG30]	[10]
Ketoprofen	DMRKXPT	Moderate	Increased risk of bleeding by the combination of Abciximab and Ketoprofen.	Chronic pain [MG30]	[10]
Levomilnacipran	DMV26S8	Moderate	Increased risk of bleeding by the combination of Abciximab and Levomilnacipran.	Chronic pain [MG30]	[11]
Anisindione	DM2C48U	Major	Increased risk of bleeding by the combination of Abciximab and Anisindione.	Coagulation defect [3B10]	[10]
Regorafenib	DMHSY1I	Major	Increased risk of bleeding by the combination of Abciximab and Regorafenib.	Colorectal cancer [2B91]	[12]
Intedanib	DMSTA36	Moderate	Increased risk of bleeding by the combination of Abciximab and Intedanib.	Colorectal cancer [2B91]	[13]
Ardeparin	DMYRX8B	Major	Increased risk of bleeding by the combination of Abciximab and Ardeparin.	Coronary thrombosis [BA43]	[14]
Danaparoid	DM6CLBN	Major	Increased risk of bleeding by the combination of Abciximab and Danaparoid.	Deep vein thrombosis [BD71]	[14]
Rivaroxaban	DMQMBZ1	Major	Increased risk of bleeding by the combination of Abciximab and Rivaroxaban.	Deep vein thrombosis [BD71]	[15]
Sertraline	DM0FB1J	Moderate	Increased risk of bleeding by the combination of Abciximab and Sertraline.	Depression [6A70-6A7Z]	[11]
Vilazodone	DM4LECQ	Moderate	Increased risk of bleeding by the combination of Abciximab and Vilazodone.	Depression [6A70-6A7Z]	[11]
Paroxetine	DM5PVQE	Moderate	Increased risk of bleeding by the combination of Abciximab and Paroxetine.	Depression [6A70-6A7Z]	[11]
Vortioxetine	DM6F1PU	Moderate	Increased risk of bleeding by the combination of Abciximab and Vortioxetine.	Depression [6A70-6A7Z]	[11]
Duloxetine	DM9BI7M	Moderate	Increased risk of bleeding by the combination of Abciximab and Duloxetine.	Depression [6A70-6A7Z]	[11]
Milnacipran	DMBFE74	Moderate	Increased risk of bleeding by the combination of Abciximab and Milnacipran.	Depression [6A70-6A7Z]	[11]
Escitalopram	DMFK9HG	Moderate	Increased risk of bleeding by the combination of Abciximab and Escitalopram.	Depression [6A70-6A7Z]	[11]
Desvenlafaxine	DMHD4PE	Moderate	Increased risk of bleeding by the combination of Abciximab and Desvenlafaxine.	Depression [6A70-6A7Z]	[11]
Clomipramine	DMINRKW	Moderate	Increased risk of bleeding by the combination of Abciximab and Clomipramine.	Depression [6A70-6A7Z]	[11]
Fluvoxamine	DMQTJSX	Moderate	Increased risk of bleeding by the combination of Abciximab and Fluvoxamine.	Depression [6A70-6A7Z]	[11]
Venlafaxine	DMR6QH0	Moderate	Increased risk of bleeding by the combination of Abciximab and Venlafaxine.	Depression [6A70-6A7Z]	[11]
Heme	DMGC287	Moderate	Increased risk of bleeding by the combination of Abciximab and Heme.	Discovery agent [N.A.]	[16]
Apigenin	DMI3491	Minor	Increased risk of bleeding by the combination of Abciximab and Apigenin.	Discovery agent [N.A.]	[17]
Citalopram derivative 1	DMITX1G	Moderate	Increased risk of bleeding by the combination of Abciximab and Citalopram derivative 1.	Discovery agent [N.A.]	[11]
PMID28870136-Compound-49	DMTUC9E	Moderate	Increased risk of bleeding by the combination of Abciximab and PMID28870136-Compound-49.	Discovery agent [N.A.]	[18]
Fenfluramine	DM0762O	Moderate	Increased risk of bleeding by the combination of Abciximab and Fenfluramine.	Epilepsy/seizure [8A61-8A6Z]	[11]
Suprofen	DMKXJZ7	Moderate	Increased risk of bleeding by the combination of Abciximab and Suprofen.	Eye anterior segment structural developmental anomaly [LA11]	[19]
Mefenamic acid	DMK7HFI	Moderate	Increased risk of bleeding by the combination of Abciximab and Mefenamic acid.	Female pelvic pain [GA34]	[10]
Avapritinib	DMK2GZX	Major	Increased risk of bleeding by the combination of Abciximab and Avapritinib.	Gastrointestinal stromal tumour [2B5B]	[12]
Tipranavir	DM8HJX6	Major	Increased risk of bleeding by the combination of Abciximab and Tipranavir.	Human immunodeficiency virus disease [1C60-1C62]	[20]
Dipyridamole	DMXY30O	Major	Increased risk of bleeding by the combination of Abciximab and Dipyridamole.	Hypertension [BA00-BA04]	[21]
Meclofenamic acid	DM05FXR	Moderate	Increased risk of bleeding by the combination of Abciximab and Meclofenamic acid.	Inflammatory spondyloarthritis [FA92]	[10]
Ticlopidine	DMO946V	Major	Increased risk of bleeding by the combination of Abciximab and Ticlopidine.	Ischaemic/haemorrhagic stroke [8B20]	[21]
Tositumomab	DMMYZ3D	Major	Increased risk of bleeding by the combination of Abciximab and Tositumomab.	Malignant haematopoietic neoplasm [2B33]	[22]
Acalabrutinib	DM7GCVW	Major	Increased risk of bleeding by the combination of Abciximab and Acalabrutinib.	Mature B-cell lymphoma [2A85]	[23]
Ibrutinib	DMHZCPO	Major	Increased risk of bleeding by the combination of Abciximab and Ibrutinib.	Mature B-cell lymphoma [2A85]	[24]
Ponatinib	DMYGJQO	Major	Increased risk of bleeding by the combination of Abciximab and Ponatinib.	Mature B-cell lymphoma [2A85]	[25]
Panobinostat	DM58WKG	Major	Increased risk of bleeding by the combination of Abciximab and Panobinostat.	Multiple myeloma [2A83]	[26]
Dasatinib	DMJV2EK	Major	Increased risk of bleeding by the combination of Abciximab and Dasatinib.	Myeloproliferative neoplasm [2A20]	[27]
Omacetaxine mepesuccinate	DMPU2WX	Major	Increased risk of bleeding by the combination of Abciximab and Omacetaxine mepesuccinate.	Myeloproliferative neoplasm [2A20]	[9]
Prasugrel	DM7MT6E	Major	Increased risk of bleeding by the combination of Abciximab and Prasugrel.	Myocardial infarction [BA41-BA43]	[21]
Vorapaxar	DMA16BR	Major	Increased risk of bleeding by the combination of Abciximab and Vorapaxar.	Myocardial infarction [BA41-BA43]	[28]
Sibutramine	DMFJTDI	Moderate	Increased risk of bleeding by the combination of Abciximab and Sibutramine.	Obesity [5B80-5B81]	[11]
Dexfenfluramine	DMJ7YDS	Moderate	Increased risk of bleeding by the combination of Abciximab and Dexfenfluramine.	Obesity [5B80-5B81]	[11]
Diclofenac	DMPIHLS	Moderate	Increased risk of bleeding by the combination of Abciximab and Diclofenac.	Osteoarthritis [FA00-FA05]	[10]
Nepafenac	DMYK490	Moderate	Increased risk of bleeding by the combination of Abciximab and Nepafenac.	Osteoarthritis [FA00-FA05]	[19]
Naproxen	DMZ5RGV	Moderate	Increased risk of bleeding by the combination of Abciximab and Naproxen.	Osteoarthritis [FA00-FA05]	[10]
MK-4827	DMLYGH4	Moderate	Increased risk of bleeding by the combination of Abciximab and MK-4827.	Ovarian cancer [2C73]	[12]
Aspirin	DM672AH	Moderate	Increased risk of bleeding by the combination of Abciximab and Aspirin.	Pain [MG30-MG3Z]	[29]
Etodolac	DM6WJO9	Moderate	Increased risk of bleeding by the combination of Abciximab and Etodolac.	Pain [MG30-MG3Z]	[10]
Diflunisal	DM7EN8I	Moderate	Increased risk of bleeding by the combination of Abciximab and Diflunisal.	Pain [MG30-MG3Z]	[29]
Ibuprofen	DM8VCBE	Moderate	Increased risk of bleeding by the combination of Abciximab and Ibuprofen.	Pain [MG30-MG3Z]	[10]
Nabumetone	DMAT2XH	Moderate	Increased risk of bleeding by the combination of Abciximab and Nabumetone.	Pain [MG30-MG3Z]	[10]
Piroxicam	DMTK234	Moderate	Increased risk of bleeding by the combination of Abciximab and Piroxicam.	Pain [MG30-MG3Z]	[10]
Choline salicylate	DM8P137	Moderate	Increased risk of bleeding by the combination of Abciximab and Choline salicylate.	Postoperative inflammation [1A00-CA43]	[29]
Ketorolac	DMI4EL5	Moderate	Increased risk of bleeding by the combination of Abciximab and Ketorolac.	Postoperative inflammation [1A00-CA43]	[10]
Bromfenac	DMKB79O	Moderate	Increased risk of bleeding by the combination of Abciximab and Bromfenac.	Postoperative inflammation [1A00-CA43]	[19]
Epoprostenol	DMUTYR2	Moderate	Increased risk of bleeding by the combination of Abciximab and Epoprostenol.	Pulmonary hypertension [BB01]	[30]
Iloprost	DMVPZBE	Moderate	Increased risk of bleeding by the combination of Abciximab and Iloprost.	Pulmonary hypertension [BB01]	[30]
Salsalate	DM13P4C	Moderate	Increased risk of bleeding by the combination of Abciximab and Salsalate.	Rheumatoid arthritis [FA20]	[29]
Meloxicam	DM2AR7L	Moderate	Increased risk of bleeding by the combination of Abciximab and Meloxicam.	Rheumatoid arthritis [FA20]	[10]
Sulindac	DM2QHZU	Moderate	Increased risk of bleeding by the combination of Abciximab and Sulindac.	Rheumatoid arthritis [FA20]	[10]
Oxaprozin	DM9UB0P	Moderate	Increased risk of bleeding by the combination of Abciximab and Oxaprozin.	Rheumatoid arthritis [FA20]	[10]
Flurbiprofen	DMGN4BY	Moderate	Increased risk of bleeding by the combination of Abciximab and Flurbiprofen.	Rheumatoid arthritis [FA20]	[19]
Fenoprofen	DML5VQ0	Moderate	Increased risk of bleeding by the combination of Abciximab and Fenoprofen.	Rheumatoid arthritis [FA20]	[10]
Indomethacin	DMSC4A7	Moderate	Increased risk of bleeding by the combination of Abciximab and Indomethacin.	Rheumatoid arthritis [FA20]	[10]
Tolmetin	DMWUIJE	Moderate	Increased risk of bleeding by the combination of Abciximab and Tolmetin.	Rheumatoid arthritis [FA20]	[10]
Salicyclic acid	DM2F8XZ	Moderate	Increased risk of bleeding by the combination of Abciximab and Salicyclic acid.	Seborrhoeic dermatitis [EA81]	[29]
Curcumin	DMQPH29	Minor	Increased risk of bleeding by the combination of Abciximab and Curcumin.	Solid tumour/cancer [2A00-2F9Z]	[31]
Warfarin	DMJYCVW	Major	Increased risk of bleeding by the combination of Abciximab and Warfarin.	Supraventricular tachyarrhythmia [BC81]	[10]
Caplacizumab	DMPUKA7	Major	Increased risk of bleeding by the combination of Abciximab and Caplacizumab.	Thrombocytopenia [3B64]	[26]
Anagrelide	DMSQ8MD	Major	Increased risk of bleeding by the combination of Abciximab and Anagrelide.	Thrombocytosis [3B63]	[10]
Apixaban	DM89JLN	Major	Increased risk of bleeding by the combination of Abciximab and Apixaban.	Thrombosis [DB61-GB90]	[12]
Cangrelor	DM8JRH0	Major	Increased risk of bleeding by the combination of Abciximab and Cangrelor.	Thrombosis [DB61-GB90]	[12]
Brilinta	DMBR01X	Moderate	Increased risk of bleeding by the combination of Abciximab and Brilinta.	Thrombosis [DB61-GB90]	[12]
Argatroban	DMFI46A	Major	Increased risk of bleeding by the combination of Abciximab and Argatroban.	Thrombosis [DB61-GB90]	[32]
Dicumarol	DMFQCB1	Major	Increased risk of bleeding by the combination of Abciximab and Dicumarol.	Thrombosis [DB61-GB90]	[33]
Clopidogrel	DMOL54H	Major	Increased risk of bleeding by the combination of Abciximab and Clopidogrel.	Thrombosis [DB61-GB90]	[21]
Cabozantinib	DMIYDT4	Major	Increased risk of bleeding by the combination of Abciximab and Cabozantinib.	Thyroid cancer [2D10]	[34]
Betrixaban	DM2C4RF	Major	Increased risk of bleeding by the combination of Abciximab and Betrixaban.	Venous thromboembolism [BD72]	[35]

References

• [1] Diagnosis, treatment, and long-term management of Kawasaki disease: a statement for health professionals from the Committee on Rheumatic Fever, Endocarditis and Kawasaki Disease, Council on Cardiovascular Disease in the Young, American Heart Association. Circulation. 2004 Oct 26;110(17):2747-71.
• [2] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6584).
• [3] Emergent carotid stenting and intra-arterial abciximab in acute ischemic stroke due to tandem occlusion. Br J Neurosurg. 2017 Oct;31(5):573-579.
• [4] Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
• [5] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
• [6] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [7] Booth SL, Golly I, Sacheck JM, Roubenoff R, Dallal GE, et al "Effect of vitamin E supplementation on vitamin K status in adults with normal coagulation status." Am J Clin Nutr 80 (2004): 143-8. [PMID: 15213041]
• [8] Product Information. Xigris (drotrecogin alfa). Lilly, Eli and Company, Indianapolis, IN.
• [9] Product Information. Brukinsa (zanubrutinib). BeiGene USA, Inc, San Mateo, CA.
• [10] Product Information. Integrilin (eptifibatide). Schering Laboratories, Kenilworth, NJ.
• [11] Alderman CP, Moritz CK, Ben-Tovim DI "Abnormal platelet aggregation associated with fluoxetine therapy." Ann Pharmacother 26 (1992): 1517-9. [PMID: 1482806]
• [12] Cerner Multum, Inc. "UK Summary of Product Characteristics.".
• [13] Product Information. Ofev (nintedanib). Boehringer Ingelheim, Ridgefield, CT.
• [14] Price AJ, Frcpath DO "Is there a clinical interaction between low molecular weight heparin and non-steroidal analgesics after total hip replacement?" Ann R Coll Surg Engl 77 (1995): 395. [PMID: 7486773]
• [15] Product Information. Xarelto (rivaroxaban). Bayer Inc, Toronto, IA.
• [16] Product Information. Panhematin (hemin). Recordati Rare Diseases Inc, Lebanon, NJ.
• [17] Heck AM, DeWitt BA, Lukes AL "Potential interactions between alternative therapies and warfarin." Am J Health Syst Pharm 57 (2000): 1221-7 quiz 1228-30. [PMID: 10902065]
• [18] Canadian Pharmacists Association.
• [19] Product Information. Acular (ketorolac). Allergan Inc, Irvine, CA.
• [20] Product Information. Aptivus (tipranavir). Boehringer-Ingelheim, Ridgefield, CT.
• [21] Klinkhardt U, Kirchmaier CM, Westrup D, Graff J, Mahnel R, Breddin HK, Harder S "Ex vivo-in vitro interaction between aspirin, clopidogrel, and the glycoprotein IIb/IIIa inhibitors abciximab and SR121566A." Clin Pharmacol Ther 67 (2000): 305-13. [PMID: 10741635]
• [22] Product Information. Bexxar I 131 Therapeutic (iodine I 131 tositumomab). GlaxoSmithKline, Research Triangle Park, NC.
• [23] Product Information. Calquence (acalabrutinib). Astra-Zeneca Pharmaceuticals, Wilmington, DE.
• [24] Agencia Espaola de Medicamentos y Productos Sanitarios Healthcare "Centro de informacion online de medicamentos de la AEMPS - CIMA.".
• [25] Product Information. Iclusig (ponatinib). Ariad Pharmaceuticals Inc, Cambridge, MA.
• [26] Cerner Multum, Inc. "Australian Product Information.".
• [27] Product Information. Sprycel (dasatinib). Bristol-Myers Squibb, Princeton, NJ.
• [28] Product Information. Zontivity (vorapaxar). Merck & Company Inc, Whitehouse Station, NJ.
• [29] Hirsch J, Dalen J, Guyatt G, American College of Chest Physicians "The sixth (2000) ACCP guidelines for antithrombotic therapy for prevention and treatment of thrombosis. American College of Physicians." Chest 119(1 Suppl) (2001): 1S-2S. [PMID: 11157638]
• [30] Product Information. Flolan (epoprostenol). Glaxo Wellcome, Research Triangle Park, NC.
• [31] Abebe W "Herbal medication: potential for adverse interactions with analgesic drugs." J Clin Pharm Ther 27 (2002): 391-401. [PMID: 12472978]
• [32] Product Information. Acova (argatroban) SmithKline Beecham, Philadelphia, PA.
• [33] Guo LQ, Yamazoe Y "Inhibition of cytochrome P450 by furanocoumarins in grapefruit juice and herbal medicines." Acta Pharmacol Sin 25 (2004): 129-36. [PMID: 14769198]
• [34] Product Information. Cometriq (cabozantinib). Exelixis Inc, S San Francisco, CA.
• [35] Product Information. Bevyxxa (betrixaban). Portola Pharmaceuticals, South San Francisco, CA.