Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEVDYN7)

DME Name Cytochrome P450 2E1 (CYP2E1)
Synonyms Cytochrome P450 family 2 subfamily E member 1; 4-nitrophenol 2-hydroxylase; Cytochrome P450-J; CYP2E; CYP2E1; CYPIIE1
Gene Name CYP2E1
UniProt ID
CP2E1_HUMAN
INTEDE ID
DME0013
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1571
EC Number EC: 1.14.14.1
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRL
AQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGP
TWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVI
ADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVA
EVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAG
TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRF
ITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGK
FKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGC
IPPRYKLCVIPRS
Function
This enzyme is involved in the metabolism of fatty acids. It catalyzes the hydroxylation of carbon-hydrogen bonds and hydroxylates fatty acids specifically at the omega-1 position displaying the highest catalytic activity for saturated fatty acids.In addition, it may be involved in the oxidative metabolism of xenobiotics.
KEGG Pathway
Arachidonic acid metabolism (hsa00590 )
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Drug metabolism - other enzymes (hsa00983 )
Linoleic acid metabolism (hsa00591 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Non-alcoholic fatty liver disease (NAFLD) (hsa04932 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
CYP2E1 reactions (R-HSA-211999 )
Xenobiotics (R-HSA-211981 )
Biosynthesis of maresin-like SPMs (R-HSA-9027307 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
74 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Acetaminophen DMUIE76 Pain MG30-MG3Z Approved [1]
Acetic Acid, Glacial DM4SJ5Y infection in the ear canal AA0Y Approved [2]
Ademetionine DMYQDBO Hepatic fibrosis DB93.0 Approved [3]
Almotriptan malate DMFG5ST Migraine 8A80 Approved [4]
Aminophylline DML2NIB Bronchial asthma CA23 Approved [5]
Amitriptyline DMK7F9S Depression 6A70-6A7Z Approved [6]
Benzyl alcohol DMBVYDI Head and body lice 1G00.0 Approved [7]
Bupropion DM5PCS7 Smoking dependence 6C4A.2 Approved [8]
Caffeine DMKBJWP Orthostatic hypotension BA21 Approved [9]
Capsaicin DMGMF6V Neuropathic pain 8E43.0 Approved [10]
Carvedilol DMHTEAO Congestive heart failure BD10 Approved [11]
Cenobamate DM8KLU9 Complex partial seizure 8A68.0 Approved [12]
Chlorzoxazone DMCYVDT Acute pain MG31 Approved [13]
Cisplatin DMRHGI9 Solid tumour/cancer 2A00-2F9Z Approved [14]
Citalopram DM2G9AE Depression 6A70-6A7Z Approved [15]
Clevidipine butyrate DMW4M97 Hypertension BA00-BA04 Approved [16]
Dacarbazine DMNPZL4 Melanoma 2C30 Approved [17]
Dalfampridine DMM0PDO Multiple sclerosis 8A40 Approved [18]
Dapsone DM4LT8A Pneumocystis pneumonia CA40.20 Approved [19]
Dexmedetomidine DM93L4X Irritability MB24 Approved [20]
Disulfiram DMCL2OK Alcohol dependence 6C40.2 Approved [21]
Dorzolamide DMA17D0 Open-angle glaucoma 9C61 Approved [22]
Enflurane DM0YJSB Anaesthesia 9A78.6 Approved [23]
Enfuvirtide DM7YPM1 Human immunodeficiency virus infection 1C62 Approved [24]
Estrone DM5T6US Menopausal and postmenopausal disorder GA30 Approved [25]
Eszopiclone DM8RZ9H Insomnia 7A00-7A0Z Approved [26]
Ethanol DMDRQZU Chronic pain MG30 Approved [27]
Ethanolamine oleate DM3B654 Bleeding disorder GA20-GA21 Approved [28]
Ethosuximide DMDZ9LT Epilepsy 8A60-8A68 Approved [29]
Etoposide DMNH3PG Solid tumour/cancer 2A00-2F9Z Approved [30]
Felbamate DM1V5ZS Epilepsy 8A60-8A68 Approved [31]
Fluoxetine DM3PD2C Depression 6A70-6A7Z Approved [15]
Folic acid DMEMBJC Folate-deficiency anemia 3A02.Y Approved [32]
Fomepizole DM6VOWQ Athylene glycol or methanol poisoning NE61 Approved [33]
Furosemide DMMQ8ZG Congestive heart failure BD10 Approved [34]
Glucosamine DM4ZLFD Osteoarthritis FA00-FA05 Approved [35]
Halothane DM80OZ5 Anaesthesia 9A78.6 Approved [36]
Isoflurane DMY6T31 Anaesthesia 9A78.6 Approved [37]
Isoniazid DM5JVS3 Tuberculosis 1B10-1B1Z Approved [3]
Levacecarnine HCL DMJBOCR Cognitive impairment 6D71 Approved [38]
Luvox DMJKROX Anxiety disorder 6B00-6B0Z Approved [15]
Menadione DMSJDTY Vitamin K deficiency 5B59 Approved [39]
Meprobamate DMHM93Y Anxiety disorder 6B00-6B0Z Approved [40]
Methoxyflurane DML0RAE Anaesthesia 9A78.6 Approved [41]
Mexiletine DMCTE9R Ventricular tachycardia BC71 Approved [42]
Mitoxantrone DMM39BF Solid tumour/cancer 2A00-2F9Z Approved [43]
Nicardipine DMCDYW7 High blood pressure BA00 Approved [31]
Nicotinamide DMUPE07 Inflammatory skin condition EF20.Y Approved [44]
Nicotine DMWX5CO Nicotine dependence 6C4A.2 Approved [45]
Ondansetron DMOTQ1I Chemotherapy-induced nausea MD90 Approved [46]
Oxaliplatin DMQNWRD Colorectal cancer 2B91.Z Approved [47]
Paramethadione DMR5ZUP Fetal trimethadione syndrome LD2F.0Y Approved [48]
Perazine DM2AOTZ Psychotic disorder 6A20-6A25 Approved [49]
Phenobarbital DMXZOCG Seizure disorder 8A6Z Approved [50]
Proguanil DMBL79I Malaria 1F40-1F45 Approved [51]
Propofol DMB4OLE Anaesthesia 9A78.6 Approved [52]
Quinidine DMLPICK Tachyarrhythmias BC71 Approved [53]
Rifampicin DM5DSFZ Osteoporosis FB83.0 Approved [54]
Sertraline DM0FB1J Depression 6A70-6A7Z Approved [55]
Sevoflurane DMC9O43 Anaesthesia 9A78.6 Approved [52]
Sildenafil citrate DMSWJ5X Erectile dysfunction HA01.1 Approved [56]
Sulfadiazine DMTW3R8 Rheumatic fever 1B40-1B42 Approved [31]
Tamoxifen DMLB0EZ Breast cancer 2C60-2C65 Approved [57]
Tegafur DM31ZQM Solid tumour/cancer 2A00-2F9Z Approved [58]
Thalidomide DM70BU5 Multiple myeloma 2A83 Approved [59]
Theobromine DMM8D3F Asthma CA23 Approved [60]
Theophylline DMRJFN9 Chronic obstructive pulmonary disease CA22 Approved [41]
Thiamylal DMHDF7B Anaesthesia 9A78.6 Approved [61]
Trabectedin DMG3Y89 Solid tumour/cancer 2A00-2F9Z Approved [62]
Trimethadione DM0Q8MZ Epilepsy 8A60-8A68 Approved [63]
Verapamil DMA7PEW Hypertension BA00-BA04 Approved [31]
Vincamine DMK1ZOR Cerebrovascular disease 8B2Z Approved [64]
Vitamin A DMJ2AH4 Night blindness 9D45 Approved [65]
Zopiclone DMPI6Z0 Insomnia 7A00-7A0Z Approved [26]
⏷ Show the Full List of 74 Approved Drug(s)
8 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
5-methoxypsoralen DME2A8X Psoriasis vulgaris EA90 Phase 3 [66]
Arc029 DMYNJHI Alzheimer disease 8A20 Phase 3 [67]
Plitidepsin DMJ8AUE Multiple myeloma 2A83 Phase 3 [68]
Tirapazamine DMBFE4K Alzheimer disease 8A20 Phase 3 [69]
Phenol DM1QSM3 N. A. N. A. Phase 2/3 [31]
BCP-13498 DM2BO9W Anaesthesia 9A78.6 Phase 2 [70]
Pyrethroids DM1794O Pest attack N.A. Phase 2 [71]
Salvinorin A DMJ3HQY Cerebral vasospasm BA85.Z Phase 1 [72]
⏷ Show the Full List of 8 Clinical Trial Drug(s)
3 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Phenacetin DMRQAM0 Analgesia MB40.8 Withdrawn from market [73]
Deramciclane DM8DUZT Anxiety disorder 6B00-6B0Z Discontinued in Phase 3 [74]
Benzydamine DMEQL9U Chemotherapy or radiotherapy-induced mucositis DA42-DA60 Discontinued in Phase 2 [35]
7 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Chloroben DMY40UB Discovery agent N.A. Investigative [75]
Chloroxylenol DMM75WZ Pseudomonas infection 1B92 Investigative [31]
Dimethylformamide DML6O4N Discovery agent N.A. Investigative [76]
N-Methyl-N-(Methylbenzyl)Formamide DMYPEX3 Discovery agent N.A. Investigative [77]
NSC-1771 DMNXDGQ Discovery agent N.A. Investigative [78]
Paraoxon DMN4ZKC Discovery agent N.A. Investigative [79]
Phenazone DMCE985 Discovery agent N.A. Investigative [80]
⏷ Show the Full List of 7 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.94E-06 7.00E-02 4.44E-01
Alopecia ED70 Skin from scalp 4.19E-05 4.85E-01 1.06E+00
Alzheimer's disease 8A20 Entorhinal cortex 1.87E-04 -1.20E-01 -3.22E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.60E-01 -2.35E-03 -2.74E-02
Aortic stenosis BB70 Calcified aortic valve 6.13E-01 2.68E-01 5.32E-01
Apnea 7A40 Hyperplastic tonsil 9.79E-02 4.92E-01 1.27E+00
Arthropathy FA00-FA5Z Peripheral blood 2.65E-01 1.91E-02 1.45E-01
Asthma CA23 Nasal and bronchial airway 2.10E-04 1.44E-01 2.04E-01
Atopic dermatitis EA80 Skin 2.85E-01 6.79E-02 1.57E-01
Autism 6A02 Whole blood 3.43E-01 1.27E-02 5.63E-02
Autoimmune uveitis 9A96 Peripheral monocyte 8.61E-01 9.52E-03 1.13E-01
Autosomal dominant monocytopenia 4B04 Whole blood 5.41E-01 1.29E-03 1.14E-02
Bacterial infection of gingival 1C1H Gingival tissue 3.18E-01 5.90E-02 1.16E-01
Batten disease 5C56.1 Whole blood 1.99E-01 1.42E-01 7.62E-01
Behcet's disease 4A62 Peripheral blood 5.63E-01 -4.80E-02 -2.52E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.85E-01 -6.88E-02 -1.64E-01
Bladder cancer 2C94 Bladder tissue 7.05E-02 2.24E-01 7.74E-01
Breast cancer 2C60-2C6Z Breast tissue 1.91E-13 6.46E-02 3.30E-01
Cardioembolic stroke 8B11.20 Whole blood 2.47E-02 -1.94E-01 -4.51E-01
Cervical cancer 2C77 Cervical tissue 5.26E-01 -5.53E-02 -1.23E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.59E-01 2.47E-02 1.23E-01
Chronic hepatitis C 1E51.1 Whole blood 9.03E-03 -1.91E-01 -1.01E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 7.08E-01 3.02E-02 1.71E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.24E-01 -8.81E-03 -4.67E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.73E-01 -1.48E-02 -1.31E-01
Colon cancer 2B90 Colon tissue 4.90E-01 -7.63E-02 -4.17E-01
Coronary artery disease BA80-BA8Z Peripheral blood 8.63E-01 -3.68E-02 -3.33E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.54E-01 -1.25E-01 -2.42E-01
Endometriosis GA10 Endometrium tissue 4.20E-01 3.70E-02 1.62E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.39E-01 6.30E-02 4.51E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.03E-01 -6.60E-02 -4.09E-01
Gastric cancer 2B72 Gastric tissue 5.80E-01 -2.76E-01 -6.46E-01
Glioblastopma 2A00.00 Nervous tissue 8.49E-94 -7.35E-01 -1.60E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.47E-01 -2.42E-01 -5.76E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.48E-01 3.53E-02 1.86E-01
Head and neck cancer 2D42 Head and neck tissue 3.00E-04 -1.73E-01 -1.17E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.67E-02 -1.16E-01 -5.42E-01
Huntington's disease 8A01.10 Whole blood 9.81E-02 1.10E-01 1.38E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.20E-01 3.19E-02 1.66E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.78E-02 -8.42E-02 -4.31E-01
Influenza 1E30 Whole blood 6.39E-01 -1.08E-02 -1.52E-01
Interstitial cystitis GC00.3 Bladder tissue 3.09E-02 1.49E-01 9.86E-01
Intracranial aneurysm 8B01.0 Intracranial artery 2.77E-02 2.60E-01 1.25E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.24E-01 3.23E-02 1.59E-01
Ischemic stroke 8B11 Peripheral blood 2.81E-01 6.10E-02 4.21E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.53E-10 -2.24E-01 -9.26E-01
Lateral sclerosis 8B60.4 Skin 5.68E-01 6.40E-02 1.83E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.09E-02 -3.26E-01 -1.59E+00
Liver cancer 2C12.0 Liver tissue 9.39E-47 -1.57E+00 -4.16E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.45E-02 -4.32E+00 -9.91E+00
Lung cancer 2C25 Lung tissue 2.89E-08 1.30E-02 8.86E-02
Lupus erythematosus 4A40 Whole blood 3.35E-07 -1.38E-01 -4.68E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.06E-01 -5.05E-02 -1.20E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.11E-01 -4.77E-02 -2.68E-01
Melanoma 2C30 Skin 8.62E-03 -1.23E+00 -1.11E+00
Multiple myeloma 2A83.1 Peripheral blood 5.05E-01 -5.50E-02 -7.63E-01
Multiple myeloma 2A83.1 Bone marrow 3.00E-06 1.50E-01 3.20E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.75E-01 -1.76E-01 -6.23E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.92E-03 1.81E-02 1.34E-01
Myelofibrosis 2A20.2 Whole blood 1.23E-01 6.68E-02 4.47E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.66E-04 -1.04E+00 -7.59E-01
Myopathy 8C70.6 Muscle tissue 6.47E-02 -1.23E-01 -8.37E-01
Neonatal sepsis KA60 Whole blood 2.57E-01 -3.65E-02 -1.83E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.84E-07 -6.21E-01 -3.73E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.39E-01 9.57E-02 2.29E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.89E-02 6.41E-02 6.54E-01
Olive pollen allergy CA08.00 Peripheral blood 4.71E-01 2.46E-02 1.78E-01
Oral cancer 2B6E Oral tissue 1.75E-04 -4.29E-01 -9.27E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.40E-01 2.81E-02 1.36E-01
Osteoporosis FB83.1 Bone marrow 8.24E-01 -9.91E-02 -3.60E-01
Ovarian cancer 2C73 Ovarian tissue 8.79E-01 -8.17E-02 -6.97E-01
Pancreatic cancer 2C10 Pancreas 6.21E-01 -4.74E-01 -8.77E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.45E-02 -1.86E-01 -9.83E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.10E-01 -5.80E-02 -5.35E-01
Pituitary cancer 2D12 Pituitary tissue 1.81E-04 3.83E-01 2.11E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.01E-04 3.85E-01 1.98E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.40E-01 -1.36E-01 -7.48E-01
Polycythemia vera 2A20.4 Whole blood 7.35E-02 7.86E-02 5.31E-01
Pompe disease 5C51.3 Biceps muscle 2.42E-01 4.17E-02 7.85E-01
Preterm birth KA21.4Z Myometrium 5.12E-01 -6.02E-02 -3.95E-01
Prostate cancer 2C82 Prostate 1.17E-01 1.32E-01 3.15E-01
Psoriasis EA90 Skin 1.05E-32 1.42E+00 2.27E+00
Rectal cancer 2B92 Rectal colon tissue 1.23E-01 -1.33E-01 -1.06E+00
Renal cancer 2C90-2C91 Kidney 1.32E-02 -4.14E-01 -8.77E-01
Retinoblastoma 2D02.2 Uvea 6.71E-04 -7.97E-01 -2.83E+00
Rheumatoid arthritis FA20 Synovial tissue 8.69E-01 6.50E-02 1.78E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.58E-01 1.31E-01 2.57E-01
Schizophrenia 6A20 Prefrontal cortex 4.20E-02 -1.71E-01 -3.15E-01
Schizophrenia 6A20 Superior temporal cortex 3.07E-01 -2.23E-02 -1.46E-01
Scleroderma 4A42.Z Whole blood 1.30E-02 1.39E-01 1.09E+00
Seizure 8A60-8A6Z Whole blood 6.09E-01 3.19E-02 2.34E-01
Sensitive skin EK0Z Skin 6.49E-01 3.07E-01 7.84E-01
Sepsis with septic shock 1G41 Whole blood 1.45E-02 -7.38E-02 -3.22E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.80E-01 3.68E-03 3.41E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.47E-01 2.86E-02 1.47E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.00E-01 3.44E-02 3.24E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.21E-01 5.69E-03 1.17E-01
Skin cancer 2C30-2C3Z Skin 1.22E-57 -1.11E+00 -1.79E+00
Thrombocythemia 3B63 Whole blood 3.45E-01 5.71E-02 4.18E-01
Thrombocytopenia 3B64 Whole blood 7.57E-01 3.09E-01 6.23E-01
Thyroid cancer 2D10 Thyroid 2.92E-10 9.21E-02 5.56E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.22E-03 -3.12E-01 -1.39E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.64E-02 -5.71E-01 -1.32E+00
Type 2 diabetes 5A11 Liver tissue 2.66E-01 1.02E-01 8.88E-01
Ureter cancer 2C92 Urothelium 9.16E-01 1.52E-02 1.17E-01
Uterine cancer 2C78 Endometrium tissue 2.23E-02 -4.31E-02 -1.51E-01
Vitiligo ED63.0 Skin 5.98E-01 9.63E-02 1.38E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Cytochrome P450 2E1 DTT Info

References

1 Acetaminophen induced acute liver failure via oxidative stress and JNK activation: protective role of taurine by the suppression of cytochrome P450 2E1. Free Radic Res. 2010 Mar;44(3):340-55.
2 Kinetics of cytochrome P450 2E1-catalyzed oxidation of ethanol to acetic acid via acetaldehyde. J Biol Chem. 1999 Aug 20;274(34):23833-40.
3 Inhibition of CYP2E1 catalytic activity in vitro by S-adenosyl-L-methionine. Biochem Pharmacol. 2005 Apr 1;69(7):1081-93.
4 Identification of the human liver enzymes involved in the metabolism of the antimigraine agent almotriptan. Drug Metab Dispos. 2003 Apr;31(4):404-11.
5 Theophylline metabolism in human liver microsomes: inhibition studies. J Pharmacol Exp Ther. 1996 Mar;276(3):912-7.
6 Five distinct human cytochromes mediate amitriptyline N-demethylation in vitro: dominance of CYP 2C19 and 3A4. J Clin Pharmacol. 1998 Feb;38(2):112-21.
7 The metabolic rate constants and specific activity of human and rat hepatic cytochrome P-450 2E1 toward toluene and chloroform. J Toxicol Environ Health A. 2004 Apr 9;67(7):537-53.
8 Validation of bupropion hydroxylation as a selective marker of human cytochrome P450 2B6 catalytic activity. Drug Metab Dispos. 2000 Oct;28(10):1222-30.
9 CYP2E1 active site residues in substrate recognition sequence 5 identified by photoaffinity labeling and homology modeling. Arch Biochem Biophys. 2007 Mar 1;459(1):59-69.
10 Metabolism of capsaicin by cytochrome P450 produces novel dehydrogenated metabolites and decreases cytotoxicity to lung and liver cells. Chem Res Toxicol. 2003 Mar;16(3):336-49.
11 In vitro identification of the human cytochrome P450 enzymes involved in the metabolism of R(+)- and S(-)-carvedilol. Drug Metab Dispos. 1997 Aug;25(8):970-7.
12 FDA label of Cenobamate. The 2020 official website of the U.S. Food and Drug Administration.
13 Trimethadione metabolism by human liver cytochrome P450: evidence for the involvement of CYP2E1. Xenobiotica. 1998 Nov;28(11):1041-7.
14 Cytochrome P450 2E1 null mice provide novel protection against cisplatin-induced nephrotoxicity and apoptosis. Kidney Int. 2003 May;63(5):1687-96.
15 Antidepressant drugs in the elderly--role of the cytochrome P450 2D6. World J Biol Psychiatry. 2003 Apr;4(2):74-80.
16 Human cytochrome p450 induction and inhibition potential of clevidipine and its primary metabolite h152/81. Drug Metab Dispos. 2006 May;34(5):734-7.
17 Role of cytochrome P450 isoenzymes in metabolism of O(6)-benzylguanine: implications for dacarbazine activation. Clin Cancer Res. 2001 Dec;7(12):4239-44.
18 Dalfampridine: a medication to improve walking in patients with multiple sclerosis. Ann Pharmacother. 2012 Jul-Aug;46(7-8):1010-5.
19 CYP2C8/9 mediate dapsone N-hydroxylation at clinical concentrations of dapsone. Drug Metab Dispos. 2000 Aug;28(8):865-8.
20 Metabolic stability and determination of cytochrome P450 isoenzymes' contribution to the metabolism of medetomidine in dog liver microsomes. Biomed Chromatogr. 2010 Aug;24(8):868-77.
21 Duration of cytochrome P-450 2E1 (CYP2E1) inhibition and estimation of functional CYP2E1 enzyme half-life after single-dose disulfiram administration in humans. J Pharmacol Exp Ther. 1999 Oct;291(1):213-9.
22 In vitro metabolism of dorzolamide, a novel potent carbonic anhydrase inhibitor, in rat liver microsomes. Drug Metab Dispos. 1994 Nov-Dec;22(6):916-21.
23 Stereoselective metabolism of enflurane by human liver cytochrome P450 2E1. Drug Metab Dispos. 1995 Dec;23(12):1426-30.
24 Pharmacokinetics, pharmacodynamics and drug interaction potential of enfuvirtide. Clin Pharmacokinet. 2005;44(2):175-86.
25 Novel metabolic pathway of estrone and 17beta-estradiol catalyzed by cytochrome P-450. Drug Metab Dispos. 2000 Feb;28(2):110-2.
26 Eszopiclone, a nonbenzodiazepine sedative-hypnotic agent for the treatment of transient and chronic insomnia. Clin Ther. 2006 Apr;28(4):491-516.
27 CYP2E1 and clinical features in alcoholics. Neuropsychobiology. 2003;47(2):86-9.
28 CYP2E1--biochemical and toxicological aspects and role in alcohol-induced liver injury. Mt Sinai J Med. 2006 Jul;73(4):657-72.
29 Characterization of the cytochrome P450 enzymes involved in the in vitro metabolism of ethosuximide by human hepatic microsomal enzymes. Xenobiotica. 2003 Mar;33(3):265-76.
30 A study on the metabolism of etoposide and possible interactions with antitumor or supporting agents by human liver microsomes. J Pharmacol Exp Ther. 1998 Sep;286(3):1294-300.
31 Summary of information on human CYP enzymes: human P450 metabolism data. Drug Metab Rev. 2002 Feb-May;34(1-2):83-448.
32 Chronic ethanol feeding and folate deficiency activate hepatic endoplasmic reticulum stress pathway in micropigs. Am J Physiol Gastrointest Liver Physiol. 2005 Jul;289(1):G54-63.
33 Treatment of patients with ethylene glycol or methanol poisoning: focus on fomepizole. Open Access Emerg Med. 2010 Aug 24;2:67-75.
34 Effects of cytochrome P450 inducers and inhibitors on the pharmacokinetics of intravenous furosemide in rats: involvement of CYP2C11, 2E1, 3A1 and 3A2 in furosemide metabolism. J Pharm Pharmacol. 2009 Jan;61(1):47-54.
35 Characterization of moclobemide N-oxidation in human liver microsomes. Xenobiotica. 2001 Jul;31(7):387-97.
36 Concordance between trifluoroacetic acid and hepatic protein trifluoroacetylation after disulfiram inhibition of halothane metabolism in rats. Acta Anaesthesiol Scand. 2003 Jul;47(6):765-70.
37 Clinical isoflurane metabolism by cytochrome P450 2E1. Anesthesiology. 1999 Mar;90(3):766-71.
38 Modulation of ethanol-mediated CYP2E1 induction by clofibrate and L-carnitine in rat liver. Biol Pharm Bull. 1993 Dec;16(12):1240-3.
39 CYP2E1 overexpression alters hepatocyte death from menadione and fatty acids by activation of ERK1/2 signaling. Hepatology. 2004 Feb;39(2):444-55.
40 Mechanisms of circadian rhythmicity of carbon tetrachloride hepatotoxicity. J Pharmacol Exp Ther. 2002 Jan;300(1):273-81.
41 Construction and assessment of models of CYP2E1: predictions of metabolism from docking, molecular dynamics, and density functional theoretical calculations. J Med Chem. 2003 Apr 24;46(9):1645-60.
42 Role of specific cytochrome P450 enzymes in the N-oxidation of the antiarrhythmic agent mexiletine. Xenobiotica. 2003 Jan;33(1):13-25.
43 FDA label of Mitoxantrone. The 2020 official website of the U.S. Food and Drug Administration.
44 Nicotinamide N-oxidation by CYP2E1 in human liver microsomes. Drug Metab Dispos. 2013 Mar;41(3):550-3.
45 Effects of nicotine on cytochrome P450 2A6 and 2E1 activities. Br J Clin Pharmacol. 2010 Feb;69(2):152-9.
46 Characterization of the cytochrome P450 enzymes involved in the in vitro metabolism of dolasetron. Comparison with other indole-containing 5-HT3 antagonists. Drug Metab Dispos. 1996 May;24(5):602-9.
47 The influence of metabolic gene polymorphisms on urinary 1-hydroxypyrene concentrations in Chinese coke oven workers. Sci Total Environ. 2007 Aug 1;381(1-3):38-46.
48 Cytochrome P450 2E1: its clinical and toxicological role. J Clin Pharm Ther. 2000 Jun;25(3):165-75.
49 Effects of phenothiazine neuroleptics on the rate of caffeine demethylation and hydroxylation in the rat liver. Pol J Pharmacol. 2001 Nov-Dec;53(6):615-21.
50 Phenobarbital induces monkey brain CYP2E1 protein but not hepatic CYP2E1, in vitro or in vivo chlorzoxazone metabolism. Eur J Pharmacol. 2006 Dec 15;552(1-3):151-8.
51 Comparison of (S)-mephenytoin and proguanil oxidation in vitro: contribution of several CYP isoforms. Br J Clin Pharmacol. 1999 Aug;48(2):158-67.
52 Inhibition of cytochrome P450 2E1 by propofol in human and porcine liver microsomes. Biochem Pharmacol. 2002 Oct 1;64(7):1151-6.
53 In vitro metabolism of quinidine: the (3S)-3-hydroxylation of quinidine is a specific marker reaction for cytochrome P-4503A4 activity in human liver microsomes. J Pharmacol Exp Ther. 1999 Apr;289(1):31-7.
54 Protective effect of rifampicin against acute liver injury induced by carbon tetrachloride in mice. Jpn J Pharmacol. 1995 Dec;69(4):325-34.
55 PharmGKB: A worldwide resource for pharmacogenomic information. Wiley Interdiscip Rev Syst Biol Med. 2018 Jul;10(4):e1417. (ID: PA166181117)
56 Erectile dysfunction drugs changed the protein expressions and activities of drug-metabolising enzymes in the liver of male rats. Oxid Med Cell Longev. 2016;2016:4970906.
57 Genotoxicity of tamoxifen, tamoxifen epoxide and toremifene in human lymphoblastoid cells containing human cytochrome P450s. Carcinogenesis. 1994 Jan;15(1):5-9.
58 Roles of cytochromes P450 1A2, 2A6, and 2C8 in 5-fluorouracil formation from tegafur, an anticancer prodrug, in human liver microsomes. Drug Metab Dispos. 2000 Dec;28(12):1457-63.
59 Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
60 Cytochrome P450 isoform selectivity in human hepatic theobromine metabolism. Br J Clin Pharmacol. 1999 Mar;47(3):299-305.
61 Effects of premedication medicines on the formation of the CYP3A4-dependent metabolite of ropivacaine, 2', 6'-Pipecoloxylidide, on human liver microsomes in vitro. Basic Clin Pharmacol Toxicol. 2006 Feb;98(2):181-3.
62 In vitro characterization of the human biotransformation and CYP reaction phenotype of ET-743 (Yondelis, Trabectidin), a novel marine anti-cancer drug. Invest New Drugs. 2006 Jan;24(1):3-14.
63 Involvement of cytochrome P450 2C9, 2E1 and 3A4 in trimethadione N-demethylation in human microsomes. J Clin Pharm Ther. 2003 Dec;28(6):493-6.
64 Characterization of human cytochrome P450 isoenzymes involved in the metabolism of vinorelbine. Fundam Clin Pharmacol. 2005 Oct;19(5):545-53.
65 The role of inflammatory cells and cytochrome P450 in the potentiation of CCl4-induced liver injury by a single dose of retinol. Toxicol Appl Pharmacol. 1996 Dec;141(2):507-19.
66 Cytochrome P450 CYP1B1 interacts with 8-methoxypsoralen (8-MOP) and influences psoralen-ultraviolet A (PUVA) sensitivity. PLoS One. 2013 Sep 23;8(9):e75494.
67 Effect of nilvadipine, a dihydropyridine calcium antagonist, on cytochrome P450 activities in human hepatic microsomes. Biol Pharm Bull. 2004 Mar;27(3):415-7.
68 In vitro characterization of the human biotransformation pathways of aplidine, a novel marine anti-cancer drug. Invest New Drugs. 2007 Feb;25(1):9-19.
69 Molecular mechanisms of tirapazamine (SR 4233, Win 59075)-induced hepatocyte toxicity under low oxygen concentrations. Br J Cancer. 1995 Apr;71(4):780-5.
70 Involvement of human cytochrome P450 2D6 in the bioactivation of acetaminophen. Drug Metab Dispos. 2000 Dec;28(12):1397-400.
71 Pyrethroids: mammalian metabolism and toxicity. J Agric Food Chem. 2011 Apr 13;59(7):2786-91.
72 Evaluation of the transport, in vitro metabolism and pharmacokinetics of Salvinorin A, a potent hallucinogen. Eur J Pharm Biopharm. 2009 Jun;72(2):471-7.
73 Involvement of CYP2E1 as A low-affinity enzyme in phenacetin O-deethylation in human liver microsomes. Drug Metab Dispos. 1999 Aug;27(8):860-5.
74 Role of CYP2E1 in deramciclane metabolism. Drug Metab Dispos. 2005 Nov;33(11):1717-22.
75 Cytochrome P450 catalyzed oxidation of monochlorobenzene, 1,2- and 1,4-dichlorobenzene in rat, mouse, and human liver microsomes. Chem Biol Interact. 1998 Aug 14;115(1):53-70.
76 Association between CYP2E1 and GOT2 gene polymorphisms and susceptibility and low-dose N,N-dimethylformamide occupational exposure-induced liver injury. Int Arch Occup Environ Health. 2019 Oct;92(7):967-975.
77 Drug Interactions Flockhart Table
78 Effect of cytochrome P450 inducers on the metabolism and toxicity of thiram in rats. Vet Hum Toxicol. 2002 Dec;44(6):331-3.
79 Interaction of ethanol and the organophosphorus insecticide parathion. Biochem Pharmacol. 1995 Nov 27;50(11):1925-32.
80 Identification of the human hepatic cytochromes P450 involved in the in vitro oxidation of antipyrine. Drug Metab Dispos. 1996 Apr;24(4):487-94.