Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEVDYN7)

• DME Name: Cytochrome P450 2E1 (CYP2E1)
• Synonyms: Cytochrome P450 family 2 subfamily E member 1; 4-nitrophenol 2-hydroxylase; Cytochrome P450-J; CYP2E; CYP2E1; CYPIIE1
• Gene Name: CYP2E1
• UniProt ID: CP2E1_HUMAN
• INTEDE ID: DME0013
• Gene ID: 1571
• EC Number:
  EC: 1.14.14.1
  Oxidoreductase
  Oxygen paired donor oxidoreductase
  Flavin/flavoprotein donor oxidoreductase
  EC: 1.14.14.1
• Lineage:
  Species: Homo sapiens
  Kingdom: Metazoa
  Phylum: Chordata
  Class: Mammalia
  Order: Primates
  Family: Hominidae
  Genus: Homo
  Species: Homo sapiens
• Sequence:
  MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRL
  AQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGP
  TWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVI
  ADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVA
  EVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAG
  TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRF
  ITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGK
  FKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGC
  IPPRYKLCVIPRS
• Function: This enzyme is involved in the metabolism of fatty acids. It catalyzes the hydroxylation of carbon-hydrogen bonds and hydroxylates fatty acids specifically at the omega-1 position displaying the highest catalytic activity for saturated fatty acids.In addition, it may be involved in the oxidative metabolism of xenobiotics.
• KEGG Pathway:
  Arachidonic acid metabolism (hsa00590)
  Chemical carcinogenesis (hsa05204)
  Drug metabolism - cytochrome P450 (hsa00982)
  Drug metabolism - other enzymes (hsa00983)
  Linoleic acid metabolism (hsa00591)
  Metabolic pathways (hsa01100)
  Metabolism of xenobiotics by cytochrome P450 (hsa00980)
  Non-alcoholic fatty liver disease (NAFLD) (hsa04932)
  Steroid hormone biosynthesis (hsa00140)
• Reactome Pathway:
  CYP2E1 reactions (R-HSA-211999)
  Xenobiotics (R-HSA-211981)
  Biosynthesis of maresin-like SPMs (R-HSA-9027307)

Molecular Interaction Atlas (MIA) of This DME

74 Approved Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Acetaminophen	DMUIE76	Allergic rhinitis	CA08.0	Approved	[1]
Acetic Acid, Glacial	DM4SJ5Y	infection in the ear canal	AA0Y	Approved	[2]
Ademetionine	DMYQDBO	Hepatic fibrosis	DB93.0	Approved	[3]
Almotriptan malate	DMFG5ST	N. A.	N. A.	Approved	[4]
Aminophylline	DML2NIB	Bronchial asthma	CA23	Approved	[5]
Amitriptyline	DMK7F9S	Depression	6A70-6A7Z	Approved	[6]
Benzyl alcohol	DMBVYDI	Head and body lice	1G00.0	Approved	[7]
Bupropion	DM5PCS7	Depression	6A70-6A7Z	Approved	[8]
Caffeine	DMKBJWP	Allergic rhinitis	CA08.0	Approved	[9]
Capsaicin	DMGMF6V	Back pain	ME84.Z	Approved	[10]
Carvedilol	DMHTEAO	Chronic heart failure	BD1Z	Approved	[11]
Cenobamate	DM8KLU9	Complex partial seizure	8A68.0	Approved	[12]
Chlorzoxazone	DMCYVDT	Acute pain	MG31	Approved	[13]
Cisplatin	DMRHGI9	Adenocarcinoma	2D40	Approved	[14]
Citalopram	DM2G9AE	Acute coronary syndrome	BA41	Approved	[15]
Clevidipine butyrate	DMW4M97	Hypertension	BA00-BA04	Approved	[16]
Dacarbazine	DMNPZL4	Adenocarcinoma	2D40	Approved	[17]
Dalfampridine	DMM0PDO	Multiple sclerosis	8A40	Approved	[18]
Dapsone	DM4LT8A	Acne vulgaris	ED80	Approved	[19]
Dexmedetomidine	DM93L4X	Irritability	MB24	Approved	[20]
Disulfiram	DMCL2OK	Alcohol dependence	6C40.2	Approved	[21]
Dorzolamide	DMA17D0	Ocular hypertension	9C61.01	Approved	[22]
Enflurane	DM0YJSB	Anaesthesia	9A78.6	Approved	[23]
Enfuvirtide	DM7YPM1	Human immunodeficiency virus infection	1C62	Approved	[24]
Estrone	DM5T6US	Acne vulgaris	ED80	Approved	[25]
Eszopiclone	DM8RZ9H	Insomnia	7A00-7A0Z	Approved	[26]
Ethanol	DMDRQZU	Chronic pain	MG30	Approved	[27]
Ethanolamine oleate	DM3B654	Bleeding disorder	GA20-GA21	Approved	[28]
Ethosuximide	DMDZ9LT	Epilepsy	8A60-8A68	Approved	[29]
Etoposide	DMNH3PG	Acute myelogenous leukaemia	2A41	Approved	[30]
Felbamate	DM1V5ZS	Epilepsy	8A60-8A68	Approved	[31]
Fluoxetine	DM3PD2C	Bipolar depression		Approved	[15]
Folic Acid	DMEMBJC	Colorectal carcinoma		Approved	[32]
Fomepizole	DM6VOWQ	Athylene glycol or methanol poisoning	NE61	Approved	[33]
Furosemide	DMMQ8ZG	Congestive heart failure	BD10	Approved	[34]
Glucosamine	DM4ZLFD	Osteoarthritis	FA00-FA05	Approved	[35]
Halothane	DM80OZ5	Anaesthesia	9A78.6	Approved	[36]
Isoflurane	DMY6T31	Anaesthesia	9A78.6	Approved	[37]
Isoniazid	DM5JVS3	Latent tuberculosis infection		Approved	[3]
Levacecarnine hci	DMJBOCR	Cognitive impairment	6D71	Approved	[38]
Luvox	DMJKROX	Anxiety disorder	6B00-6B0Z	Approved	[15]
Menadione	DMSJDTY	Vitamin K deficiency	5B59	Approved	[39]
Meprobamate	DMHM93Y	Anxiety		Approved	[40]
Methoxyflurane	DML0RAE	Anaesthesia	9A78.6	Approved	[41]
Mexiletine	DMCTE9R	Ventricular tachycardia	BC71	Approved	[42]
Mitoxantrone	DMM39BF	Acute myelogenous leukaemia	2A41	Approved	[43]
Nicardipine	DMCDYW7	High blood pressure	BA00	Approved	[31]
Nicotinamide	DMUPE07	Acne vulgaris	ED80	Approved	[44]
Nicotine	DMWX5CO	Lung cancer	2C25.0	Approved	[45]
Ondansetron	DMOTQ1I	Chemotherapy-induced nausea	MD90	Approved	[46]
Oxaliplatin	DMQNWRD	Adenocarcinoma	2D40	Approved	[47]
Paramethadione	DMR5ZUP	Absence epilepsy		Approved	[48]
Perazine	DM2AOTZ	Psychotic disorder	6A20-6A25	Approved	[49]
Phenobarbital	DMXZOCG	Cluster headache	8A81.0	Approved	[50]
Proguanil	DMBL79I	Malaria	1F40-1F45	Approved	[51]
Propofol	DMB4OLE	Anaesthesia	9A78.6	Approved	[52]
Quinidine	DMLPICK	N. A.	N. A.	Approved	[53]
Rifampicin	DM5DSFZ	Non-insulin dependent diabetes	5A11	Approved	[54]
Sertraline	DM0FB1J	Coronary heart disease	BA80.Z	Approved	[55]
Sevoflurane	DMC9O43	Anaesthesia	9A78.6	Approved	[52]
Sildenafil citrate	DMSWJ5X	N. A.	N. A.	Approved	[56]
Sulfadiazine	DMTW3R8	Rheumatic fever	1B40-1B42	Approved	[31]
Tamoxifen	DMLB0EZ	Breast cancer	2C60-2C65	Approved	[57]
Tegafur	DM31ZQM	Solid tumour/cancer	2A00-2F9Z	Approved	[58]
Thalidomide	DM70BU5	Adult T-cell leukemia/lymphoma		Approved	[59]
Theobromine	DMM8D3F	Asthma	CA23	Approved	[60]
Theophylline	DMRJFN9	Bronchitis	CA20	Approved	[41]
Thiamylal	DMHDF7B	Anaesthesia	9A78.6	Approved	[61]
Trabectedin	DMG3Y89	Leiomyosarcoma	2B58	Approved	[62]
Trimethadione	DM0Q8MZ	Absence epilepsy		Approved	[63]
Verapamil	DMA7PEW	Angina pectoris	BA40	Approved	[31]
Vincamine	DMK1ZOR	Cerebrovascular disease	8B2Z	Approved	[64]
Vitamin A	DMJ2AH4	Night blindness	9D45	Approved	[65]
Zopiclone	DMPI6Z0	Insomnia	7A00-7A0Z	Approved	[26]

8 Clinical Trial Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
5-methoxypsoralen	DME2A8X	Psoriasis vulgaris	EA90	Phase 3	[66]
ARC029	DMYNJHI	Alzheimer disease	8A20	Phase 3	[67]
Plitidepsin	DMJ8AUE	Multiple myeloma	2A83	Phase 3	[68]
Tirapazamine	DMBFE4K	Alzheimer disease	8A20	Phase 3	[69]
PHENOL	DM1QSM3	N. A.	N. A.	Phase 2/3	[31]
BCP-13498	DM2BO9W	N. A.	N. A.	Phase 2	[70]
Pyrethroids	DM1794O	Pest attack	N.A.	Phase 2	[71]
SALVINORIN A	DMJ3HQY	Cerebral vasospasm	BA85.Z	Phase 1	[72]

3 Discontinued Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Phenacetin	DMRQAM0	Analgesia	MB40.8	Withdrawn from market	[73]
Deramciclane	DM8DUZT	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 3	[74]
Benzydamine	DMEQL9U	Chemotherapy or radiotherapy-induced mucositis	DA42-DA60	Discontinued in Phase 2	[35]

7 Investigative Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Chloroben	DMY40UB	N. A.	N. A.	Investigative	[75]
Chloroxylenol	DMM75WZ	N. A.	N. A.	Investigative	[31]
Dimethylformamide	DML6O4N	Discovery agent	N.A.	Investigative	[76]
N-Methyl-N-(Methylbenzyl)Formamide	DMYPEX3	Discovery agent	N.A.	Investigative	[77]
NSC-1771	DMNXDGQ	Discovery agent	N.A.	Investigative	[78]
PARAOXON	DMN4ZKC	Discovery agent	N.A.	Investigative	[79]
Phenazone	DMCE985	Discovery agent	N.A.	Investigative	[80]

Molecular Expression Atlas (MEA) of This DME

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	1.94E-06	7.00E-02	4.44E-01
Alopecia	ED70	Skin from scalp	4.19E-05	4.85E-01	1.06E+00
Alzheimer's disease	8A20	Entorhinal cortex	1.87E-04	-1.20E-01	-3.22E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	2.60E-01	-2.35E-03	-2.74E-02
Aortic stenosis	BB70	Calcified aortic valve	6.13E-01	2.68E-01	5.32E-01
Apnea	7A40	Hyperplastic tonsil	9.79E-02	4.92E-01	1.27E+00
Arthropathy	FA00-FA5Z	Peripheral blood	2.65E-01	1.91E-02	1.45E-01
Asthma	CA23	Nasal and bronchial airway	2.10E-04	1.44E-01	2.04E-01
Atopic dermatitis	EA80	Skin	2.85E-01	6.79E-02	1.57E-01
Autism	6A02	Whole blood	3.43E-01	1.27E-02	5.63E-02
Autoimmune uveitis	9A96	Peripheral monocyte	8.61E-01	9.52E-03	1.13E-01
Autosomal dominant monocytopenia	4B04	Whole blood	5.41E-01	1.29E-03	1.14E-02
Bacterial infection of gingival	1C1H	Gingival tissue	3.18E-01	5.90E-02	1.16E-01
Batten disease	5C56.1	Whole blood	1.99E-01	1.42E-01	7.62E-01
Behcet's disease	4A62	Peripheral blood	5.63E-01	-4.80E-02	-2.52E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	4.85E-01	-6.88E-02	-1.64E-01
Bladder cancer	2C94	Bladder tissue	7.05E-02	2.24E-01	7.74E-01
Breast cancer	2C60-2C6Z	Breast tissue	1.91E-13	6.46E-02	3.30E-01
Cardioembolic stroke	8B11.20	Whole blood	2.47E-02	-1.94E-01	-4.51E-01
Cervical cancer	2C77	Cervical tissue	5.26E-01	-5.53E-02	-1.23E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	9.59E-01	2.47E-02	1.23E-01
Chronic hepatitis C	1E51.1	Whole blood	9.03E-03	-1.91E-01	-1.01E+00
Chronic obstructive pulmonary disease	CA22	Lung tissue	7.08E-01	3.02E-02	1.71E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	9.24E-01	-8.81E-03	-4.67E-02
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	6.73E-01	-1.48E-02	-1.31E-01
Colon cancer	2B90	Colon tissue	4.90E-01	-7.63E-02	-4.17E-01
Coronary artery disease	BA80-BA8Z	Peripheral blood	8.63E-01	-3.68E-02	-3.33E-01
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	7.54E-01	-1.25E-01	-2.42E-01
Endometriosis	GA10	Endometrium tissue	4.20E-01	3.70E-02	1.62E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	3.39E-01	6.30E-02	4.51E-01
Familial hypercholesterolemia	5C80.00	Whole blood	1.03E-01	-6.60E-02	-4.09E-01
Gastric cancer	2B72	Gastric tissue	5.80E-01	-2.76E-01	-6.46E-01
Glioblastopma	2A00.00	Nervous tissue	8.49E-94	-7.35E-01	-1.60E+00
Glioma	2A00.0Y-2A00.0Z	Brain stem tissue	6.47E-01	-2.42E-01	-5.76E-01
Glioma	2A00.0Y-2A00.0Z	White matter tissue	3.48E-01	3.53E-02	1.86E-01
Head and neck cancer	2D42	Head and neck tissue	3.00E-04	-1.73E-01	-1.17E-01
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	4.67E-02	-1.16E-01	-5.42E-01
Huntington's disease	8A01.10	Whole blood	9.81E-02	1.10E-01	1.38E+00
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	8.20E-01	3.19E-02	1.66E-01
Immunodeficiency	4A00-4A20	Peripheral blood	7.78E-02	-8.42E-02	-4.31E-01
Influenza	1E30	Whole blood	6.39E-01	-1.08E-02	-1.52E-01
Interstitial cystitis	GC00.3	Bladder tissue	3.09E-02	1.49E-01	9.86E-01
Intracranial aneurysm	8B01.0	Intracranial artery	2.77E-02	2.60E-01	1.25E+00
Irritable bowel syndrome	DD91.0	Rectal colon tissue	5.24E-01	3.23E-02	1.59E-01
Ischemic stroke	8B11	Peripheral blood	2.81E-01	6.10E-02	4.21E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	9.53E-10	-2.24E-01	-9.26E-01
Lateral sclerosis	8B60.4	Skin	5.68E-01	6.40E-02	1.83E-01
Lateral sclerosis	8B60.4	Cervical spinal cord	1.09E-02	-3.26E-01	-1.59E+00
Liver cancer	2C12.0	Liver tissue	9.39E-47	-1.57E+00	-4.16E+00
Liver failure	DB99.7-DB99.8	Liver tissue	1.45E-02	-4.32E+00	-9.91E+00
Lung cancer	2C25	Lung tissue	2.89E-08	1.30E-02	8.86E-02
Lupus erythematosus	4A40	Whole blood	3.35E-07	-1.38E-01	-4.68E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	9.06E-01	-5.05E-02	-1.20E-01
Major depressive disorder	6A70-6A7Z	Whole blood	1.11E-01	-4.77E-02	-2.68E-01
Melanoma	2C30	Skin	8.62E-03	-1.23E+00	-1.11E+00
Multiple myeloma	2A83.1	Peripheral blood	5.05E-01	-5.50E-02	-7.63E-01
Multiple myeloma	2A83.1	Bone marrow	3.00E-06	1.50E-01	3.20E+00
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	7.75E-01	-1.76E-01	-6.23E-01
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	7.92E-03	1.81E-02	1.34E-01
Myelofibrosis	2A20.2	Whole blood	1.23E-01	6.68E-02	4.47E-01
Myocardial infarction	BA41-BA50	Peripheral blood	2.66E-04	-1.04E+00	-7.59E-01
Myopathy	8C70.6	Muscle tissue	6.47E-02	-1.23E-01	-8.37E-01
Neonatal sepsis	KA60	Whole blood	2.57E-01	-3.65E-02	-1.83E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	2.84E-07	-6.21E-01	-3.73E+00
Non-alcoholic fatty liver disease	DB92	Liver tissue	1.39E-01	9.57E-02	2.29E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	4.89E-02	6.41E-02	6.54E-01
Olive pollen allergy	CA08.00	Peripheral blood	4.71E-01	2.46E-02	1.78E-01
Oral cancer	2B6E	Oral tissue	1.75E-04	-4.29E-01	-9.27E-01
Osteoarthritis	FA00-FA0Z	Synovial tissue	2.40E-01	2.81E-02	1.36E-01
Osteoporosis	FB83.1	Bone marrow	8.24E-01	-9.91E-02	-3.60E-01
Ovarian cancer	2C73	Ovarian tissue	8.79E-01	-8.17E-02	-6.97E-01
Pancreatic cancer	2C10	Pancreas	6.21E-01	-4.74E-01	-8.77E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	9.45E-02	-1.86E-01	-9.83E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	1.10E-01	-5.80E-02	-5.35E-01
Pituitary cancer	2D12	Pituitary tissue	1.81E-04	3.83E-01	2.11E+00
Pituitary gonadotrope tumour	2D12	Pituitary tissue	4.01E-04	3.85E-01	1.98E+00
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	2.40E-01	-1.36E-01	-7.48E-01
Polycythemia vera	2A20.4	Whole blood	7.35E-02	7.86E-02	5.31E-01
Pompe disease	5C51.3	Biceps muscle	2.42E-01	4.17E-02	7.85E-01
Preterm birth	KA21.4Z	Myometrium	5.12E-01	-6.02E-02	-3.95E-01
Prostate cancer	2C82	Prostate	1.17E-01	1.32E-01	3.15E-01
Psoriasis	EA90	Skin	1.05E-32	1.42E+00	2.27E+00
Rectal cancer	2B92	Rectal colon tissue	1.23E-01	-1.33E-01	-1.06E+00
Renal cancer	2C90-2C91	Kidney	1.32E-02	-4.14E-01	-8.77E-01
Retinoblastoma	2D02.2	Uvea	6.71E-04	-7.97E-01	-2.83E+00
Rheumatoid arthritis	FA20	Synovial tissue	8.69E-01	6.50E-02	1.78E-01
Rhinovirus infection	CA42.1	Nasal epithelium tissue	8.58E-01	1.31E-01	2.57E-01
Schizophrenia	6A20	Prefrontal cortex	4.20E-02	-1.71E-01	-3.15E-01
Schizophrenia	6A20	Superior temporal cortex	3.07E-01	-2.23E-02	-1.46E-01
Scleroderma	4A42.Z	Whole blood	1.30E-02	1.39E-01	1.09E+00
Seizure	8A60-8A6Z	Whole blood	6.09E-01	3.19E-02	2.34E-01
Sensitive skin	EK0Z	Skin	6.49E-01	3.07E-01	7.84E-01
Sepsis with septic shock	1G41	Whole blood	1.45E-02	-7.38E-02	-3.22E-01
Shwachman-Diamond syndrome	3A70.0	Bone marrow	7.80E-01	3.68E-03	3.41E-02
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	9.47E-01	2.86E-02	1.47E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	8.00E-01	3.44E-02	3.24E-01
Sjogren's syndrome	4A43.2	Salivary gland tissue	3.21E-01	5.69E-03	1.17E-01
Skin cancer	2C30-2C3Z	Skin	1.22E-57	-1.11E+00	-1.79E+00
Thrombocythemia	3B63	Whole blood	3.45E-01	5.71E-02	4.18E-01
Thrombocytopenia	3B64	Whole blood	7.57E-01	3.09E-01	6.23E-01
Thyroid cancer	2D10	Thyroid	2.92E-10	9.21E-02	5.56E-01
Tibial muscular dystrophy	8C75	Muscle tissue	2.22E-03	-3.12E-01	-1.39E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	8.64E-02	-5.71E-01	-1.32E+00
Type 2 diabetes	5A11	Liver tissue	2.66E-01	1.02E-01	8.88E-01
Ureter cancer	2C92	Urothelium	9.16E-01	1.52E-02	1.17E-01
Uterine cancer	2C78	Endometrium tissue	2.23E-02	-4.31E-02	-1.51E-01
Vitiligo	ED63.0	Skin	5.98E-01	9.63E-02	1.38E-01

The Drug Therapeutic Target (DTT) Role of This DME

• DME DTT Name: Cytochrome P450 2E1 DTT Info

References

• [1] Acetaminophen induced acute liver failure via oxidative stress and JNK activation: protective role of taurine by the suppression of cytochrome P450 2E1. Free Radic Res. 2010 Mar;44(3):340-55.
• [2] Kinetics of cytochrome P450 2E1-catalyzed oxidation of ethanol to acetic acid via acetaldehyde. J Biol Chem. 1999 Aug 20;274(34):23833-40.
• [3] Inhibition of CYP2E1 catalytic activity in vitro by S-adenosyl-L-methionine. Biochem Pharmacol. 2005 Apr 1;69(7):1081-93.
• [4] Identification of the human liver enzymes involved in the metabolism of the antimigraine agent almotriptan. Drug Metab Dispos. 2003 Apr;31(4):404-11.
• [5] Theophylline metabolism in human liver microsomes: inhibition studies. J Pharmacol Exp Ther. 1996 Mar;276(3):912-7.
• [6] Five distinct human cytochromes mediate amitriptyline N-demethylation in vitro: dominance of CYP 2C19 and 3A4. J Clin Pharmacol. 1998 Feb;38(2):112-21.
• [7] The metabolic rate constants and specific activity of human and rat hepatic cytochrome P-450 2E1 toward toluene and chloroform. J Toxicol Environ Health A. 2004 Apr 9;67(7):537-53.
• [8] Validation of bupropion hydroxylation as a selective marker of human cytochrome P450 2B6 catalytic activity. Drug Metab Dispos. 2000 Oct;28(10):1222-30.
• [9] CYP2E1 active site residues in substrate recognition sequence 5 identified by photoaffinity labeling and homology modeling. Arch Biochem Biophys. 2007 Mar 1;459(1):59-69.
• [10] Metabolism of capsaicin by cytochrome P450 produces novel dehydrogenated metabolites and decreases cytotoxicity to lung and liver cells. Chem Res Toxicol. 2003 Mar;16(3):336-49.
• [11] In vitro identification of the human cytochrome P450 enzymes involved in the metabolism of R(+)- and S(-)-carvedilol. Drug Metab Dispos. 1997 Aug;25(8):970-7.
• [12] FDA label of Cenobamate. The 2020 official website of the U.S. Food and Drug Administration.
• [13] Trimethadione metabolism by human liver cytochrome P450: evidence for the involvement of CYP2E1. Xenobiotica. 1998 Nov;28(11):1041-7.
• [14] Cytochrome P450 2E1 null mice provide novel protection against cisplatin-induced nephrotoxicity and apoptosis. Kidney Int. 2003 May;63(5):1687-96.
• [15] Antidepressant drugs in the elderly--role of the cytochrome P450 2D6. World J Biol Psychiatry. 2003 Apr;4(2):74-80.
• [16] Human cytochrome p450 induction and inhibition potential of clevidipine and its primary metabolite h152/81. Drug Metab Dispos. 2006 May;34(5):734-7.
• [17] Role of cytochrome P450 isoenzymes in metabolism of O(6)-benzylguanine: implications for dacarbazine activation. Clin Cancer Res. 2001 Dec;7(12):4239-44.
• [18] Dalfampridine: a medication to improve walking in patients with multiple sclerosis. Ann Pharmacother. 2012 Jul-Aug;46(7-8):1010-5.
• [19] CYP2C8/9 mediate dapsone N-hydroxylation at clinical concentrations of dapsone. Drug Metab Dispos. 2000 Aug;28(8):865-8.
• [20] Metabolic stability and determination of cytochrome P450 isoenzymes' contribution to the metabolism of medetomidine in dog liver microsomes. Biomed Chromatogr. 2010 Aug;24(8):868-77.
• [21] Duration of cytochrome P-450 2E1 (CYP2E1) inhibition and estimation of functional CYP2E1 enzyme half-life after single-dose disulfiram administration in humans. J Pharmacol Exp Ther. 1999 Oct;291(1):213-9.
• [22] In vitro metabolism of dorzolamide, a novel potent carbonic anhydrase inhibitor, in rat liver microsomes. Drug Metab Dispos. 1994 Nov-Dec;22(6):916-21.
• [23] Stereoselective metabolism of enflurane by human liver cytochrome P450 2E1. Drug Metab Dispos. 1995 Dec;23(12):1426-30.
• [24] Pharmacokinetics, pharmacodynamics and drug interaction potential of enfuvirtide. Clin Pharmacokinet. 2005;44(2):175-86.
• [25] Novel metabolic pathway of estrone and 17beta-estradiol catalyzed by cytochrome P-450. Drug Metab Dispos. 2000 Feb;28(2):110-2.
• [26] Eszopiclone, a nonbenzodiazepine sedative-hypnotic agent for the treatment of transient and chronic insomnia. Clin Ther. 2006 Apr;28(4):491-516.
• [27] CYP2E1 and clinical features in alcoholics. Neuropsychobiology. 2003;47(2):86-9.
• [28] CYP2E1--biochemical and toxicological aspects and role in alcohol-induced liver injury. Mt Sinai J Med. 2006 Jul;73(4):657-72.
• [29] Characterization of the cytochrome P450 enzymes involved in the in vitro metabolism of ethosuximide by human hepatic microsomal enzymes. Xenobiotica. 2003 Mar;33(3):265-76.
• [30] A study on the metabolism of etoposide and possible interactions with antitumor or supporting agents by human liver microsomes. J Pharmacol Exp Ther. 1998 Sep;286(3):1294-300.
• [31] Summary of information on human CYP enzymes: human P450 metabolism data. Drug Metab Rev. 2002 Feb-May;34(1-2):83-448.
• [32] Chronic ethanol feeding and folate deficiency activate hepatic endoplasmic reticulum stress pathway in micropigs. Am J Physiol Gastrointest Liver Physiol. 2005 Jul;289(1):G54-63.
• [33] Treatment of patients with ethylene glycol or methanol poisoning: focus on fomepizole. Open Access Emerg Med. 2010 Aug 24;2:67-75.
• [34] Effects of cytochrome P450 inducers and inhibitors on the pharmacokinetics of intravenous furosemide in rats: involvement of CYP2C11, 2E1, 3A1 and 3A2 in furosemide metabolism. J Pharm Pharmacol. 2009 Jan;61(1):47-54.
• [35] Characterization of moclobemide N-oxidation in human liver microsomes. Xenobiotica. 2001 Jul;31(7):387-97.
• [36] Concordance between trifluoroacetic acid and hepatic protein trifluoroacetylation after disulfiram inhibition of halothane metabolism in rats. Acta Anaesthesiol Scand. 2003 Jul;47(6):765-70.
• [37] Clinical isoflurane metabolism by cytochrome P450 2E1. Anesthesiology. 1999 Mar;90(3):766-71.
• [38] Modulation of ethanol-mediated CYP2E1 induction by clofibrate and L-carnitine in rat liver. Biol Pharm Bull. 1993 Dec;16(12):1240-3.
• [39] CYP2E1 overexpression alters hepatocyte death from menadione and fatty acids by activation of ERK1/2 signaling. Hepatology. 2004 Feb;39(2):444-55.
• [40] Mechanisms of circadian rhythmicity of carbon tetrachloride hepatotoxicity. J Pharmacol Exp Ther. 2002 Jan;300(1):273-81.
• [41] Construction and assessment of models of CYP2E1: predictions of metabolism from docking, molecular dynamics, and density functional theoretical calculations. J Med Chem. 2003 Apr 24;46(9):1645-60.
• [42] Role of specific cytochrome P450 enzymes in the N-oxidation of the antiarrhythmic agent mexiletine. Xenobiotica. 2003 Jan;33(1):13-25.
• [43] FDA label of Mitoxantrone. The 2020 official website of the U.S. Food and Drug Administration.
• [44] Nicotinamide N-oxidation by CYP2E1 in human liver microsomes. Drug Metab Dispos. 2013 Mar;41(3):550-3.
• [45] Effects of nicotine on cytochrome P450 2A6 and 2E1 activities. Br J Clin Pharmacol. 2010 Feb;69(2):152-9.
• [46] Characterization of the cytochrome P450 enzymes involved in the in vitro metabolism of dolasetron. Comparison with other indole-containing 5-HT3 antagonists. Drug Metab Dispos. 1996 May;24(5):602-9.
• [47] The influence of metabolic gene polymorphisms on urinary 1-hydroxypyrene concentrations in Chinese coke oven workers. Sci Total Environ. 2007 Aug 1;381(1-3):38-46.
• [48] Cytochrome P450 2E1: its clinical and toxicological role. J Clin Pharm Ther. 2000 Jun;25(3):165-75.
• [49] Effects of phenothiazine neuroleptics on the rate of caffeine demethylation and hydroxylation in the rat liver. Pol J Pharmacol. 2001 Nov-Dec;53(6):615-21.
• [50] Phenobarbital induces monkey brain CYP2E1 protein but not hepatic CYP2E1, in vitro or in vivo chlorzoxazone metabolism. Eur J Pharmacol. 2006 Dec 15;552(1-3):151-8.
• [51] Comparison of (S)-mephenytoin and proguanil oxidation in vitro: contribution of several CYP isoforms. Br J Clin Pharmacol. 1999 Aug;48(2):158-67.
• [52] Inhibition of cytochrome P450 2E1 by propofol in human and porcine liver microsomes. Biochem Pharmacol. 2002 Oct 1;64(7):1151-6.
• [53] In vitro metabolism of quinidine: the (3S)-3-hydroxylation of quinidine is a specific marker reaction for cytochrome P-4503A4 activity in human liver microsomes. J Pharmacol Exp Ther. 1999 Apr;289(1):31-7.
• [54] Protective effect of rifampicin against acute liver injury induced by carbon tetrachloride in mice. Jpn J Pharmacol. 1995 Dec;69(4):325-34.
• [55] PharmGKB: A worldwide resource for pharmacogenomic information. Wiley Interdiscip Rev Syst Biol Med. 2018 Jul;10(4):e1417. (ID: PA166181117)
• [56] Erectile dysfunction drugs changed the protein expressions and activities of drug-metabolising enzymes in the liver of male rats. Oxid Med Cell Longev. 2016;2016:4970906.
• [57] Genotoxicity of tamoxifen, tamoxifen epoxide and toremifene in human lymphoblastoid cells containing human cytochrome P450s. Carcinogenesis. 1994 Jan;15(1):5-9.
• [58] Roles of cytochromes P450 1A2, 2A6, and 2C8 in 5-fluorouracil formation from tegafur, an anticancer prodrug, in human liver microsomes. Drug Metab Dispos. 2000 Dec;28(12):1457-63.
• [59] Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
• [60] Cytochrome P450 isoform selectivity in human hepatic theobromine metabolism. Br J Clin Pharmacol. 1999 Mar;47(3):299-305.
• [61] Effects of premedication medicines on the formation of the CYP3A4-dependent metabolite of ropivacaine, 2', 6'-Pipecoloxylidide, on human liver microsomes in vitro. Basic Clin Pharmacol Toxicol. 2006 Feb;98(2):181-3.
• [62] In vitro characterization of the human biotransformation and CYP reaction phenotype of ET-743 (Yondelis, Trabectidin), a novel marine anti-cancer drug. Invest New Drugs. 2006 Jan;24(1):3-14.
• [63] Involvement of cytochrome P450 2C9, 2E1 and 3A4 in trimethadione N-demethylation in human microsomes. J Clin Pharm Ther. 2003 Dec;28(6):493-6.
• [64] Characterization of human cytochrome P450 isoenzymes involved in the metabolism of vinorelbine. Fundam Clin Pharmacol. 2005 Oct;19(5):545-53.
• [65] The role of inflammatory cells and cytochrome P450 in the potentiation of CCl4-induced liver injury by a single dose of retinol. Toxicol Appl Pharmacol. 1996 Dec;141(2):507-19.
• [66] Cytochrome P450 CYP1B1 interacts with 8-methoxypsoralen (8-MOP) and influences psoralen-ultraviolet A (PUVA) sensitivity. PLoS One. 2013 Sep 23;8(9):e75494.
• [67] Effect of nilvadipine, a dihydropyridine calcium antagonist, on cytochrome P450 activities in human hepatic microsomes. Biol Pharm Bull. 2004 Mar;27(3):415-7.
• [68] In vitro characterization of the human biotransformation pathways of aplidine, a novel marine anti-cancer drug. Invest New Drugs. 2007 Feb;25(1):9-19.
• [69] Molecular mechanisms of tirapazamine (SR 4233, Win 59075)-induced hepatocyte toxicity under low oxygen concentrations. Br J Cancer. 1995 Apr;71(4):780-5.
• [70] Involvement of human cytochrome P450 2D6 in the bioactivation of acetaminophen. Drug Metab Dispos. 2000 Dec;28(12):1397-400.
• [71] Pyrethroids: mammalian metabolism and toxicity. J Agric Food Chem. 2011 Apr 13;59(7):2786-91.
• [72] Evaluation of the transport, in vitro metabolism and pharmacokinetics of Salvinorin A, a potent hallucinogen. Eur J Pharm Biopharm. 2009 Jun;72(2):471-7.
• [73] Involvement of CYP2E1 as A low-affinity enzyme in phenacetin O-deethylation in human liver microsomes. Drug Metab Dispos. 1999 Aug;27(8):860-5.
• [74] Role of CYP2E1 in deramciclane metabolism. Drug Metab Dispos. 2005 Nov;33(11):1717-22.
• [75] Cytochrome P450 catalyzed oxidation of monochlorobenzene, 1,2- and 1,4-dichlorobenzene in rat, mouse, and human liver microsomes. Chem Biol Interact. 1998 Aug 14;115(1):53-70.
• [76] Association between CYP2E1 and GOT2 gene polymorphisms and susceptibility and low-dose N,N-dimethylformamide occupational exposure-induced liver injury. Int Arch Occup Environ Health. 2019 Oct;92(7):967-975.
• [77] Drug Interactions Flockhart Table
• [78] Effect of cytochrome P450 inducers on the metabolism and toxicity of thiram in rats. Vet Hum Toxicol. 2002 Dec;44(6):331-3.
• [79] Interaction of ethanol and the organophosphorus insecticide parathion. Biochem Pharmacol. 1995 Nov 27;50(11):1925-32.
• [80] Identification of the human hepatic cytochromes P450 involved in the in vitro oxidation of antipyrine. Drug Metab Dispos. 1996 Apr;24(4):487-94.