Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1K65VW)

DOT Name Extracellular matrix protein 1 (ECM1)
Synonyms Secretory component p85
Gene Name ECM1
Related Disease
Colorectal carcinoma ( )
Lipoid proteinosis ( )
Advanced cancer ( )
Autoimmune disease ( )
Cervical cancer ( )
Cervical carcinoma ( )
Cholangiocarcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Congenital contractural arachnodactyly ( )
Congenital nervous system disorder ( )
Corneal neovascularization ( )
Epilepsy ( )
Epithelial ovarian cancer ( )
Esophageal squamous cell carcinoma ( )
Hepatocellular carcinoma ( )
IgA nephropathy ( )
Inflammation ( )
Inflammatory bowel disease ( )
Laryngeal carcinoma ( )
Matthew-Wood syndrome ( )
Myocardial infarction ( )
Non-small-cell lung cancer ( )
Prostate cancer ( )
Prostate carcinoma ( )
Prostate neoplasm ( )
Psoriasis ( )
Skin disease ( )
Squamous cell carcinoma ( )
Stomach cancer ( )
Thyroid gland carcinoma ( )
Uterine fibroids ( )
Vascular disease ( )
Breast cancer ( )
Crohn disease ( )
Gastric neoplasm ( )
Hereditary diffuse gastric adenocarcinoma ( )
Melanoma ( )
Metastatic malignant neoplasm ( )
Thyroid cancer ( )
Thyroid tumor ( )
Age-related macular degeneration ( )
Bladder cancer ( )
Gastric cancer ( )
Nervous system disease ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
UniProt ID
ECM1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF05782
Sequence
MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHP
DSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSL
QHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQI
CLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLVWEEA
MSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLRACPSHQPDISSGLELPFP
PGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWK
AWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPN
LMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIW
RDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE
Function Involved in endochondral bone formation as negative regulator of bone mineralization. Stimulates the proliferation of endothelial cells and promotes angiogenesis. Inhibits MMP9 proteolytic activity.
Tissue Specificity
Expressed in breast cancer tissues. Little or no expression observed in normal breast tissues. Expressed in skin; wide expression is observed throughout the dermis with minimal expression in the epidermis.
Reactome Pathway
Platelet degranulation (R-HSA-114608 )

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Colorectal carcinoma DIS5PYL0 Definitive Biomarker [1]
Lipoid proteinosis DISHAODY Definitive Autosomal recessive [2]
Advanced cancer DISAT1Z9 Strong Biomarker [3]
Autoimmune disease DISORMTM Strong Biomarker [4]
Cervical cancer DISFSHPF Strong Biomarker [5]
Cervical carcinoma DIST4S00 Strong Biomarker [5]
Cholangiocarcinoma DIS71F6X Strong Altered Expression [6]
Colon cancer DISVC52G Strong Altered Expression [7]
Colon carcinoma DISJYKUO Strong Altered Expression [7]
Congenital contractural arachnodactyly DISOM1K7 Strong Altered Expression [6]
Congenital nervous system disorder DIS2BIP8 Strong Genetic Variation [8]
Corneal neovascularization DISKOGZP Strong Altered Expression [9]
Epilepsy DISBB28L Strong Genetic Variation [10]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [11]
Esophageal squamous cell carcinoma DIS5N2GV Strong Altered Expression [12]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [13]
IgA nephropathy DISZ8MTK Strong Biomarker [14]
Inflammation DISJUQ5T Strong Biomarker [15]
Inflammatory bowel disease DISGN23E Strong Genetic Variation [16]
Laryngeal carcinoma DISNHCIV Strong Altered Expression [17]
Matthew-Wood syndrome DISA7HR7 Strong Biomarker [18]
Myocardial infarction DIS655KI Strong Biomarker [19]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [20]
Prostate cancer DISF190Y Strong Biomarker [21]
Prostate carcinoma DISMJPLE Strong Biomarker [21]
Prostate neoplasm DISHDKGQ Strong Altered Expression [21]
Psoriasis DIS59VMN Strong Biomarker [22]
Skin disease DISDW8R6 Strong Biomarker [23]
Squamous cell carcinoma DISQVIFL Strong Altered Expression [12]
Stomach cancer DISKIJSX Strong Biomarker [24]
Thyroid gland carcinoma DISMNGZ0 Strong Altered Expression [25]
Uterine fibroids DISBZRMJ Strong Altered Expression [26]
Vascular disease DISVS67S Strong Biomarker [27]
Breast cancer DIS7DPX1 moderate Biomarker [28]
Crohn disease DIS2C5Q8 moderate Biomarker [15]
Gastric neoplasm DISOKN4Y moderate Biomarker [24]
Hereditary diffuse gastric adenocarcinoma DISUIBYS moderate Biomarker [24]
Melanoma DIS1RRCY moderate Altered Expression [29]
Metastatic malignant neoplasm DIS86UK6 moderate Biomarker [30]
Thyroid cancer DIS3VLDH Disputed Altered Expression [25]
Thyroid tumor DISLVKMD Disputed Altered Expression [25]
Age-related macular degeneration DIS0XS2C Limited Genetic Variation [31]
Bladder cancer DISUHNM0 Limited Altered Expression [3]
Gastric cancer DISXGOUK Limited Biomarker [24]
Nervous system disease DISJ7GGT Limited Genetic Variation [32]
Urinary bladder cancer DISDV4T7 Limited Altered Expression [3]
Urinary bladder neoplasm DIS7HACE Limited Altered Expression [3]
------------------------------------------------------------------------------------
⏷ Show the Full List of 47 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Extracellular matrix protein 1 (ECM1). [33]
Ivermectin DMDBX5F Approved Ivermectin increases the expression of Extracellular matrix protein 1 (ECM1). [34]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Extracellular matrix protein 1 (ECM1). [35]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Extracellular matrix protein 1 (ECM1). [36]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Extracellular matrix protein 1 (ECM1). [37]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Extracellular matrix protein 1 (ECM1). [38]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Extracellular matrix protein 1 (ECM1). [39]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Extracellular matrix protein 1 (ECM1). [41]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Extracellular matrix protein 1 (ECM1). [42]
Nitrobenzanthrone DMN6L70 Investigative Nitrobenzanthrone affects the expression of Extracellular matrix protein 1 (ECM1). [43]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Extracellular matrix protein 1 (ECM1). [40]
------------------------------------------------------------------------------------

References

1 Genetics of ulcerative colitis.Inflamm Bowel Dis. 2011 Mar;17(3):831-48. doi: 10.1002/ibd.21375. Epub 2010 Nov 12.
2 Temporal lobe epilepsy and emotion recognition without amygdala: a case study of Urbach-Wiethe disease and review of the literature. Epileptic Disord. 2014 Dec;16(4):518-27. doi: 10.1684/epd.2014.0696.
3 Extracellular matrix protein 1 (ECM1) is associated with carcinogenesis potential of human bladder cancer.Onco Targets Ther. 2019 Feb 20;12:1423-1432. doi: 10.2147/OTT.S191321. eCollection 2019.
4 Clinical Features, Complications and Autoimmunity in Male Lichen Sclerosus.Acta Derm Venereol. 2017 Mar 10;97(3):365-369. doi: 10.2340/00015555-2537.
5 MiR-486-3p targeting ECM1 represses cell proliferation and metastasis in cervical cancer.Biomed Pharmacother. 2016 May;80:109-114. doi: 10.1016/j.biopha.2016.02.019. Epub 2016 Mar 18.
6 Overexpression of ECM1 contributes to migration and invasion in cholangiocarcinoma cell.Neoplasma. 2012;59(4):409-15. doi: 10.4149/neo_2012_053.
7 Proteomic Analysis of Liquid Biopsy from Tumor-Draining Vein Indicates that High Expression of Exosomal ECM1 Is Associated with Relapse in Stage I-III Colon Cancer.Transl Oncol. 2018 Jun;11(3):715-721. doi: 10.1016/j.tranon.2018.03.010. Epub 2018 Apr 13.
8 Lipoid proteinosis.Handb Clin Neurol. 2015;132:317-22. doi: 10.1016/B978-0-444-62702-5.00023-8.
9 Public data mining plus domestic experimental study defined involvement of the old-yet-uncharacterized gene matrix-remodeling associated 7 (MXRA7) in physiopathology of the eye.Gene. 2017 Oct 20;632:43-49. doi: 10.1016/j.gene.2017.08.018. Epub 2017 Aug 26.
10 The Characteristics and Long-Term Course of Epilepsy in Lipoid Proteinosis: A Spectrum From Mild to Severe Seizures in Relation to ECM1 Mutations.Clin EEG Neurosci. 2018 May;49(3):192-196. doi: 10.1177/1550059417705280. Epub 2017 Apr 23.
11 Mining Featured Biomarkers Linked with Epithelial Ovarian CancerBased on Bioinformatics.Diagnostics (Basel). 2019 Apr 9;9(2):39. doi: 10.3390/diagnostics9020039.
12 Endoplasmic reticulum-localized ECM1b suppresses tumor growth and regulates MYC and MTORC1 through modulating MTORC2 activation in esophageal squamous cell carcinoma.Cancer Lett. 2019 Oct 1;461:56-64. doi: 10.1016/j.canlet.2019.07.005. Epub 2019 Jul 15.
13 Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
14 Characterization of glomerular extracellular matrix in IgA nephropathy by proteomic analysis of laser-captured microdissected glomeruli.BMC Nephrol. 2019 Nov 14;20(1):410. doi: 10.1186/s12882-019-1598-1.
15 Serum Protein Biomarkers of Fibrosis Aid in Risk Stratification of Future Stricturing Complications in Pediatric Crohn's Disease.Am J Gastroenterol. 2019 May;114(5):777-785. doi: 10.14309/ajg.0000000000000237.
16 eQTL analysis links inflammatory bowel disease associated 1q21 locus to ECM1 gene.J Appl Genet. 2016 Aug;57(3):363-72. doi: 10.1007/s13353-015-0334-1. Epub 2016 Jan 6.
17 Correlation of ECM1 expression level with the pathogenesis and metastasis of laryngeal carcinoma.Int J Clin Exp Pathol. 2013 May 15;6(6):1132-7. Print 2013.
18 miR-23a-5p inhibits cell proliferation and invasion in pancreatic ductal adenocarcinoma by suppressing ECM1 expression.Am J Transl Res. 2019 May 15;11(5):2983-2994. eCollection 2019.
19 Novel role of extracellular matrix protein 1 (ECM1) in cardiac aging and myocardial infarction.PLoS One. 2019 Feb 21;14(2):e0212230. doi: 10.1371/journal.pone.0212230. eCollection 2019.
20 Tumor-derived exosomal proteins as diagnostic biomarkers in non-small cell lung cancer.Cancer Sci. 2019 Jan;110(1):433-442. doi: 10.1111/cas.13862. Epub 2018 Dec 6.
21 Protective effect of stromal Dickkopf-3 in prostate cancer: opposing roles for TGFBI and ECM-1.Oncogene. 2018 Sep;37(39):5305-5324. doi: 10.1038/s41388-018-0294-0. Epub 2018 Jun 1.
22 mRNA and protein expression of the angiogenesis-related genes EDIL3, AMOT and ECM1 in mesenchymal stem cells in psoriatic dermis.Clin Exp Dermatol. 2016 Jul;41(5):533-40. doi: 10.1111/ced.12783. Epub 2015 Dec 8.
23 The role of extracellular matrix protein 1 in human skin.Clin Exp Dermatol. 2004 Jan;29(1):52-6. doi: 10.1111/j.1365-2230.2004.01440.x.
24 MiR-92a antagonized the facilitation effect of extracellular matrix protein 1 in GC metastasis through targeting its 3'UTR region.Food Chem Toxicol. 2019 Nov;133:110779. doi: 10.1016/j.fct.2019.110779. Epub 2019 Aug 28.
25 Vitamin D receptor expression is linked to potential markers of human thyroid papillary carcinoma.J Steroid Biochem Mol Biol. 2016 May;159:26-30. doi: 10.1016/j.jsbmb.2016.02.016. Epub 2016 Feb 22.
26 Epidermal growth factor-containing fibulin-like extracellular matrix protein 1 expression and regulation in uterine leiomyoma.Fertil Steril. 2016 Apr;105(4):1070-5. doi: 10.1016/j.fertnstert.2015.12.004. Epub 2015 Dec 17.
27 Lipoid proteinosis maps to 1q21 and is caused by mutations in the extracellular matrix protein 1 gene (ECM1). Hum Mol Genet. 2002 Apr 1;11(7):833-40. doi: 10.1093/hmg/11.7.833.
28 Extracellular matrix protein 1 recruits moesin to facilitate invadopodia formation and breast cancer metastasis.Cancer Lett. 2018 Nov 28;437:44-55. doi: 10.1016/j.canlet.2018.08.022. Epub 2018 Aug 27.
29 Human Melanoma cells over-express extracellular matrix 1 (ECM1) which is regulated by TFAP2C.PLoS One. 2013 Sep 2;8(9):e73953. doi: 10.1371/journal.pone.0073953. eCollection 2013.
30 Extracellular matrix protein 1 promotes cell metastasis and glucose metabolism by inducing integrin 4/FAK/SOX2/HIF-1 signaling pathway in gastric cancer.Oncogene. 2018 Feb 8;37(6):744-755. doi: 10.1038/onc.2017.363. Epub 2017 Oct 23.
31 Compromised mutant EFEMP1 secretion associated with macular dystrophy remedied by proteostasis network alteration.Mol Biol Cell. 2011 Dec;22(24):4765-75. doi: 10.1091/mbc.E11-08-0695. Epub 2011 Oct 26.
32 Extracellular matrix protein 1 inhibits the activity of matrix metalloproteinase 9 through high-affinity protein/protein interactions.Exp Dermatol. 2006 Apr;15(4):300-7. doi: 10.1111/j.0906-6705.2006.00409.x.
33 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
34 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
35 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
36 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
37 Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
38 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
39 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
40 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
41 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
42 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
43 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.