Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT37A2MD)

• DOT Name: Msx2-interacting protein (SPEN)
• Synonyms: SMART/HDAC1-associated repressor protein; SPEN homolog
• Gene Name: SPEN
• Related Disease:
  Radio-Tartaglia syndrome
  Acute megakaryoblastic leukemia
  Adenoma
  Advanced cancer
  Alzheimer disease
  Breast neoplasm
  Carcinoma
  Colonic neoplasm
  Colorectal carcinoma
  Cryohydrocytosis
  Cytomegalovirus infection
  Familial adenomatous polyposis
  Hepatitis B virus infection
  Hereditary nonpolyposis colon cancer
  Neoplasm
  Prostate carcinoma
  Prostate neoplasm
  Renal cell carcinoma
  Lung neoplasm
  Non-small-cell lung cancer
  Urinary bladder cancer
  Aplasia cutis congenita
  Asthma
  Corpus callosum, agenesis of
  Melanoma
  Myotonic dystrophy
  Myotonic dystrophy type 1
  Prostate cancer
  Psychotic disorder
  Tuberculosis
  Complex neurodevelopmental disorder
• UniProt ID: MINT_HUMAN
• PDB ID: 1OW1; 2RT5; 4P6Q; 7Z1K
• Pfam ID: PF20809 ; PF20808 ; PF20810 ; PF00076 ; PF07744
• Sequence:
  MVRETRHLWVGNLPENVREEKIIEHFKRYGRVESVKILPKRGSEGGVAAFVDFVDIKSAQ
  KAHNSVNKMGDRDLRTDYNEPGTIPSAARGLDDTVSIASRSREVSGFRGGGGGPAYGPPP
  SLHAREGRYERRLDGASDNRERAYEHSAYGHHERGTGGFDRTRHYDQDYYRDPRERTLQH
  GLYYASRSRSPNRFDAHDPRYEPRAREQFTLPSVVHRDIYRDDITREVRGRRPERNYQHS
  RSRSPHSSQSRNQSPQRLASQASRPTRSPSGSGSRSRSSSSDSISSSSSTSSDSSDSSSS
  SSDDSPARSVQSAAVPAPTSQLLSSLEKDEPRKSFGIKVQNLPVRSTDTSLKDGLFHEFK
  KFGKVTSVQIHGTSEERYGLVFFRQQEDQEKALTASKGKLFFGMQIEVTAWIGPETESEN
  EFRPLDERIDEFHPKATRTLFIGNLEKTTTYHDLRNIFQRFGEIVDIDIKKVNGVPQYAF
  LQYCDIASVCKAIKKMDGEYLGNNRLKLGFGKSMPTNCVWLDGLSSNVSDQYLTRHFCRY
  GPVVKVVFDRLKGMALVLYNEIEYAQAAVKETKGRKIGGNKIKVDFANRESQLAFYHCME
  KSGQDIRDFYEMLAERREERRASYDYNQDRTYYESVRTPGTYPEDSRRDYPARGREFYSE
  WETYQGDYYESRYYDDPREYRDYRNDPYEQDIREYSYRQRERERERERFESDRDRDHERR
  PIERSQSPVHLRRPQSPGASPSQAERLPSDSERRLYSRSSDRSGSCSSLSPPRYEKLDKS
  RLERYTKNEKTDKERTFDPERVERERRLIRKEKVEKDKTDKQKRKGKVHSPSSQSSETDQ
  ENEREQSPEKPRSCNKLSREKADKEGIAKNRLELMPCVVLTRVKEKEGKVIDHTPVEKLK
  AKLDNDTVKSSALDQKLQVSQTEPAKSDLSKLESVRMKVPKEKGLSSHVEVVEKEGRLKA
  RKHLKPEQPADGVSAVDLEKLEARKRRFADSNLKAEKQKPEVKKSSPEMEDARVLSKKQP
  DVSSREVILLREGEAERKPVRKEILKRESKKIKLDRLNTVASPKDCQELASISVGSGSRP
  SSDLQARLGELAGESVENQEVQSKKPIPSKPQLKQLQVLDDQGPEREDVRKNYCSLRDET
  PERKSGQEKSHSVNTEEKIGIDIDHTQSYRKQMEQSRRKQQMEMEIAKSEKFGSPKKDVD
  EYERRSLVHEVGKPPQDVTDDSPPSKKKRMDHVDFDICTKRERNYRSSRQISEDSERTGG
  SPSVRHGSFHEDEDPIGSPRLLSVKGSPKVDEKVLPYSNITVREESLKFNPYDSSRREQM
  ADMAKIKLSVLNSEDELNRWDSQMKQDAGRFDVSFPNSIIKRDSLRKRSVRDLEPGEVPS
  DSDEDGEHKSHSPRASALYESSRLSFLLRDREDKLRERDERLSSSLERNKFYSFALDKTI
  TPDTKALLERAKSLSSSREENWSFLDWDSRFANFRNNKDKEKVDSAPRPIPSWYMKKKKI
  RTDSEGKMDDKKEDHKEEEQERQELFASRFLHSSIFEQDSKRLQHLERKEEDSDFISGRI
  YGKQTSEGANSTTDSIQEPVVLFHSRFMELTRMQQKEKEKDQKPKEVEKQEDTENHPKTP
  ESAPENKDSELKTPPSVGPPSVTVVTLESAPSALEKTTGDKTVEAPLVTEEKTVEPATVS
  EEAKPASEPAPAPVEQLEQVDLPPGADPDKEAAMMPAGVEEGSSGDQPPYLDAKPPTPGA
  SFSQAESNVDPEPDSTQPLSKPAQKSEEANEPKAEKPDATADAEPDANQKAEAAPESQPP
  ASEDLEVDPPVAAKDKKPNKSKRSKTPVQAAAVSIVEKPVTRKSERIDREKLKRSNSPRG
  EAQKLLELKMEAEKITRTASKNSAADLEHPEPSLPLSRTRRRNVRSVYATMGDHENRSPV
  KEPVEQPRVTRKRLERELQEAAAVPTTPRRGRPPKTRRRADEEEENEAKEPAETLKPPEG
  WRSPRSQKTAAGGGPQGKKGKNEPKVDATRPEATTEVGPQIGVKESSMEPKAAEEEAGSE
  QKRDRKDAGTDKNPPETAPVEVVEKKPAPEKNSKSKRGRSRNSRLAVDKSASLKNVDAAV
  SPRGAAAQAGERESGVVAVSPEKSESPQKEDGLSSQLKSDPVDPDKEPEKEDVSASGPSP
  EATQLAKQMELEQAVEHIAKLAEASASAAYKADAPEGLAPEDRDKPAHQASETELAAAIG
  SIINDISGEPENFPAPPPYPGESQTDLQPPAGAQALQPSEEGMETDEAVSGILETEAATE
  SSRPPVNAPDPSAGPTDTKEARGNSSETSHSVPEAKGSKEVEVTLVRKDKGRQKTTRSRR
  KRNTNKKVVAPVESHVPESNQAQGESPAANEGTTVQHPEAPQEEKQSEKPHSTPPQSCTS
  DLSKIPSTENSSQEISVEERTPTKASVPPDLPPPPQPAPVDEEPQARFRVHSIIESDPVT
  PPSDPSIPIPTLPSVTAAKLSPPVASGGIPHQSPPTKVTEWITRQEEPRAQSTPSPALPP
  DTKASDVDTSSSTLRKILMDPKYVSATSVTSTSVTTAIAEPVSAAPCLHEAPPPPVDSKK
  PLEEKTAPPVTNNSEIQASEVLVAADKEKVAPVIAPKITSVISRMPVSIDLENSQKITLA
  KPAPQTLTGLVSALTGLVNVSLVPVNALKGPVKGSVTTLKSLVSTPAGPVNVLKGPVNVL
  TGPVNVLTTPVNATVGTVNAAPGTVNAAASAVNATASAVTVTAGAVTAASGGVTATTGTV
  TMAGAVIAPSTKCKQRASANENSRFHPGSMPVIDDRPADAGSGAGLRVNTSEGVVLLSYS
  GQKTEGPQRISAKISQIPPASAMDIEFQQSVSKSQVKPDSVTASQPPSKGPQAPAGYANV
  ATHSTLVLTAQTYNASPVISSVKADRPSLEKPEPIHLSVSTPVTQGGTVKVLTQGINTPP
  VLVHNQLVLTPSIVTTNKKLADPVTLKIETKVLQPANLGSTLTPHHPPALPSKLPTEVNH
  VPSGPSIPADRTVSHLAAAKLDAHSPRPSGPGPSSFPRASHPSSTASTALSTNATVMLAA
  GIPVPQFISSIHPEQSVIMPPHSITQTVSLSHLSQGEVRMNTPTLPSITYSIRPEALHSP
  RAPLQPQQIEVRAPQRASTPQPAPAGVPALASQHPPEEEVHYHLPVARATAPVQSEVLVM
  QSEYRLHPYTVPRDVRIMVHPHVTAVSEQPRAADGVVKVPPASKAPQQPGKEAAKTPDAK
  AAPTPTPAPVPVPVPLPAPAPAPHGEARILTVTPSNQLQGLPLTPPVVVTHGVQIVHSSG
  ELFQEYRYGDIRTYHPPAQLTHTQFPAASSVGLPSRTKTAAQGPPPEGEPLQPPQPVQST
  QPAQPAPPCPPSQLGQPGQPPSSKMPQVSQEAKGTQTGVEQPRLPAGPANRPPEPHTQVQ
  RAQAETGPTSFPSPVSVSMKPDLPVSLPTQTAPKQPLFVPTTSGPSTPPGLVLPHTEFQP
  APKQDSSPHLTSQRPVDMVQLLKKYPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPL
  SEGGPPLRIAQRMRLEATQLEGVARRMTVETDYCLLLALPCGRDQEDVVSQTESLKAAFI
  TYLQAKQAAGIINVPNPGSNQPAYVLQIFPPCEFSESHLSRLAPDLLASISNISPHLMIV
  IASV
• Function: May serve as a nuclear matrix platform that organizes and integrates transcriptional responses. In osteoblasts, supports transcription activation: synergizes with RUNX2 to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element (OCFRE). Has also been shown to be an essential corepressor protein, which probably regulates different key pathways such as the Notch pathway. Negative regulator of the Notch pathway via its interaction with RBPSUH, which prevents the association between NOTCH1 and RBPSUH, and therefore suppresses the transactivation activity of Notch signaling. Blocks the differentiation of precursor B-cells into marginal zone B-cells. Probably represses transcription via the recruitment of large complexes containing histone deacetylase proteins. May bind both to DNA and RNA.
• Tissue Specificity: Expressed at high level in brain, testis, spleen and thymus. Expressed at intermediate level in kidney, liver, mammary gland and skin.
• KEGG Pathway: Notch sig.ling pathway (hsa04330)
• Reactome Pathway: RHOBTB1 GTPase cycle (R-HSA-9013422)

Molecular Interaction Atlas (MIA) of This DOT

31 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Radio-Tartaglia syndrome	DIS25K6C	Definitive	Autosomal dominant	[1]
Acute megakaryoblastic leukemia	DIS0JX3M	Strong	Genetic Variation	[2]
Adenoma	DIS78ZEV	Strong	Altered Expression	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Alzheimer disease	DISF8S70	Strong	Biomarker	[5]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[6]
Carcinoma	DISH9F1N	Strong	Altered Expression	[3]
Colonic neoplasm	DISSZ04P	Strong	Biomarker	[7]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[8]
Cryohydrocytosis	DISMQHL3	Strong	Genetic Variation	[9]
Cytomegalovirus infection	DISCEMGC	Strong	Biomarker	[10]
Familial adenomatous polyposis	DISW53RE	Strong	Genetic Variation	[11]
Hepatitis B virus infection	DISLQ2XY	Strong	Altered Expression	[12]
Hereditary nonpolyposis colon cancer	DISPA49R	Strong	Posttranslational Modification	[13]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[14]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[15]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[16]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[14]
Lung neoplasm	DISVARNB	moderate	Biomarker	[4]
Non-small-cell lung cancer	DIS5Y6R9	Disputed	Genetic Variation	[17]
Urinary bladder cancer	DISDV4T7	Disputed	Genetic Variation	[17]
Aplasia cutis congenita	DISMDAYM	Limited	Genetic Variation	[18]
Asthma	DISW9QNS	Limited	Biomarker	[19]
Corpus callosum, agenesis of	DISO9P40	Limited	Genetic Variation	[18]
Melanoma	DIS1RRCY	Limited	Altered Expression	[20]
Myotonic dystrophy	DISNBEMX	Limited	Biomarker	[21]
Myotonic dystrophy type 1	DISJC0OX	Limited	Altered Expression	[21]
Prostate cancer	DISF190Y	Limited	Biomarker	[15]
Psychotic disorder	DIS4UQOT	Limited	Biomarker	[22]
Tuberculosis	DIS2YIMD	Limited	Biomarker	[23]
Complex neurodevelopmental disorder	DISB9AFI	No Known	Autosomal dominant	[1]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Temozolomide	DMKECZD	Approved	Msx2-interacting protein (SPEN) affects the response to substance of Temozolomide.	[43]
DTI-015	DMXZRW0	Approved	Msx2-interacting protein (SPEN) affects the response to substance of DTI-015.	[43]

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Msx2-interacting protein (SPEN).	[24]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Msx2-interacting protein (SPEN).	[25]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Msx2-interacting protein (SPEN).	[26]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Msx2-interacting protein (SPEN).	[27]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Msx2-interacting protein (SPEN).	[28]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Msx2-interacting protein (SPEN).	[30]
Marinol	DM70IK5	Approved	Marinol increases the expression of Msx2-interacting protein (SPEN).	[31]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Msx2-interacting protein (SPEN).	[32]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Msx2-interacting protein (SPEN).	[33]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate increases the expression of Msx2-interacting protein (SPEN).	[34]
Liothyronine	DM6IR3P	Approved	Liothyronine increases the expression of Msx2-interacting protein (SPEN).	[35]
Enzalutamide	DMGL19D	Approved	Enzalutamide affects the expression of Msx2-interacting protein (SPEN).	[36]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Msx2-interacting protein (SPEN).	[37]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Msx2-interacting protein (SPEN).	[32]
UNC0379	DMD1E4J	Preclinical	UNC0379 decreases the expression of Msx2-interacting protein (SPEN).	[41]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Msx2-interacting protein (SPEN).	[42]

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Msx2-interacting protein (SPEN).	[29]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Msx2-interacting protein (SPEN).	[38]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Msx2-interacting protein (SPEN).	[39]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Msx2-interacting protein (SPEN).	[40]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Msx2-interacting protein (SPEN).	[40]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Involvement of a human gene related to the Drosophila spen gene in the recurrent t(1;22) translocation of acute megakaryocytic leukemia.Proc Natl Acad Sci U S A. 2001 May 8;98(10):5776-9. doi: 10.1073/pnas.101001498.
• [3] Drosophila split ends homologue SHARP functions as a positive regulator of Wnt/beta-catenin/T-cell factor signaling in neoplastic transformation.Cancer Res. 2007 Jan 15;67(2):482-91. doi: 10.1158/0008-5472.CAN-06-2314.
• [4] Oligogenic germline mutations identified in early non-smokers lung adenocarcinoma patients.Lung Cancer. 2014 Aug;85(2):168-74. doi: 10.1016/j.lungcan.2014.05.020. Epub 2014 Jun 4.
• [5] Open-closed motion of Mint2 regulates APP metabolism.J Mol Cell Biol. 2013 Feb;5(1):48-56. doi: 10.1093/jmcb/mjs033. Epub 2012 Jun 21.
• [6] The Estrogen Receptor Cofactor SPEN Functions as a Tumor Suppressor and Candidate Biomarker of Drug Responsiveness in Hormone-Dependent Breast Cancers.Cancer Res. 2015 Oct 15;75(20):4351-63. doi: 10.1158/0008-5472.CAN-14-3475. Epub 2015 Aug 21.
• [7] Oncogenetic tree model of somatic mutations and DNA methylation in colon tumors.Genes Chromosomes Cancer. 2009 Jan;48(1):1-9. doi: 10.1002/gcc.20614.
• [8] 18q loss of heterozygosity in microsatellite stable colorectal cancer is correlated with CpG island methylator phenotype-negative (CIMP-0) and inversely with CIMP-low and CIMP-high.BMC Cancer. 2007 May 2;7:72. doi: 10.1186/1471-2407-7-72.
• [9] Characteristic patterns of altered DNA methylation predict emergence of human hepatocellular carcinoma.Hepatology. 2012 Sep;56(3):994-1003. doi: 10.1002/hep.25706. Epub 2012 Aug 2.
• [10] Evaluation of the AmpliSensor PCR and the SHARP signal detection system for the early prediction of symptomatic CMV infection in solid transplant recipients.J Clin Virol. 1999 Jun;13(1-2):81-94. doi: 10.1016/s1386-6532(99)00013-x.
• [11] Epigenetic-genetic interactions in the APC/WNT, RAS/RAF, and P53 pathways in colorectal carcinoma.Clin Cancer Res. 2008 May 1;14(9):2560-9. doi: 10.1158/1078-0432.CCR-07-1802.
• [12] Evaluation of SHARP signal system for enzymatic detection of amplified hepatitis B virus DNA.J Clin Microbiol. 1995 Feb;33(2):477-80. doi: 10.1128/jcm.33.2.477-480.1995.
• [13] Promoter hypermethylation frequency and BRAF mutations distinguish hereditary non-polyposis colon cancer from sporadic MSI-H colon cancer.Fam Cancer. 2004;3(2):101-7. doi: 10.1023/B:FAME.0000039861.30651.c8.
• [14] Genetic clustering of clear cell renal cell carcinoma based on array-comparative genomic hybridization: its association with DNA methylation alteration and patient outcome.Clin Cancer Res. 2008 Sep 1;14(17):5531-9. doi: 10.1158/1078-0432.CCR-08-0443.
• [15] SHARP hypofractionated stereotactic radiotherapy for localized prostate cancer: a biochemical response to treatment.J BUON. 2019 Sep-Oct;24(5):2099-2106.
• [16] The long tail of oncogenic drivers in prostate cancer.Nat Genet. 2018 May;50(5):645-651. doi: 10.1038/s41588-018-0078-z. Epub 2018 Apr 2.
• [17] Examination of a CpG island methylator phenotype and implications of methylation profiles in solid tumors.Cancer Res. 2006 Nov 1;66(21):10621-9. doi: 10.1158/0008-5472.CAN-06-1687.
• [18] Whole exome sequencing of adenoid cystic carcinoma.J Clin Invest. 2013 Jul;123(7):2965-8. doi: 10.1172/JCI67201. Epub 2013 Jun 17.
• [19] Integration of mouse and human genome-wide association data identifies KCNIP4 as an asthma gene.PLoS One. 2013;8(2):e56179. doi: 10.1371/journal.pone.0056179. Epub 2013 Feb 14.
• [20] The Prognostic Significance of Low-Frequency Somatic Mutations in Metastatic Cutaneous Melanoma.Front Oncol. 2019 Jan 4;8:584. doi: 10.3389/fonc.2018.00584. eCollection 2018.
• [21] RNA steady-state defects in myotonic dystrophy are linked to nuclear exclusion of SHARP.EMBO Rep. 2011 Jul 1;12(7):735-42. doi: 10.1038/embor.2011.86.
• [22] Poor functional recovery is better predicted than conversion in studies of outcomes of clinical high risk of psychosis: insight from SHARP.Psychol Med. 2020 Jul;50(9):1578-1584. doi: 10.1017/S0033291719002174. Epub 2019 Aug 27.
• [23] Comparison of the Roche AMPLICOR MYCOBACTERIUM assay and Digene SHARP Signal System with in-house PCR and culture for detection of Mycobacterium tuberculosis in respiratory specimens.J Clin Microbiol. 1996 Dec;34(12):3092-6. doi: 10.1128/jcm.34.12.3092-3096.1996.
• [24] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [25] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [26] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [27] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [28] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [29] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [30] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [31] Delta9-tetrahydrocannabinol inhibits cytotrophoblast cell proliferation and modulates gene transcription. Mol Hum Reprod. 2006 May;12(5):321-33. doi: 10.1093/molehr/gal036. Epub 2006 Apr 5.
• [32] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [33] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [34] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [35] Monitoring of deiodinase deficiency based on transcriptomic responses in SH-SY5Y cells. Arch Toxicol. 2013 Jun;87(6):1103-13. doi: 10.1007/s00204-013-1018-4. Epub 2013 Feb 10.
• [36] NOTCH signaling is activated in and contributes to resistance in enzalutamide-resistant prostate cancer cells. J Biol Chem. 2019 May 24;294(21):8543-8554. doi: 10.1074/jbc.RA118.006983. Epub 2019 Apr 2.
• [37] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [38] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [39] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [40] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [41] Epigenetic siRNA and chemical screens identify SETD8 inhibition as a therapeutic strategy for p53 activation in high-risk neuroblastoma. Cancer Cell. 2017 Jan 9;31(1):50-63.
• [42] Identification of gene markers for formaldehyde exposure in humans. Environ Health Perspect. 2007 Oct;115(10):1460-6. doi: 10.1289/ehp.10180.
• [43] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.