Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT47MCLI)

• DOT Name: B-cell lymphoma/leukemia 10 (BCL10)
• Synonyms: B-cell CLL/lymphoma 10; Bcl-10; CARD-containing molecule enhancing NF-kappa-B; CARD-like apoptotic protein; hCLAP; CED-3/ICH-1 prodomain homologous E10-like regulator; CIPER; Cellular homolog of vCARMEN; cCARMEN; Cellular-E10; c-E10; Mammalian CARD-containing adapter molecule E10; mE10
• Gene Name: BCL10
• Related Disease:
  Cervical cancer
  Cervical carcinoma
  Epithelial ovarian cancer
  Immunodeficiency 37
  Lymphoma, non-Hodgkin, familial
  Non-hodgkin lymphoma
  Acute myelogenous leukaemia
  Adenocarcinoma
  Autoimmune disease
  Bladder cancer
  Breast carcinoma
  Breast neoplasm
  Carcinoma
  Carcinoma of esophagus
  Childhood acute lymphoblastic leukemia
  Classic Hodgkin lymphoma
  Colon cancer
  Colon carcinoma
  Endometrial carcinoma
  Esophageal squamous cell carcinoma
  Germ cell tumor
  Glioma
  Hepatocellular carcinoma
  Immunodeficiency
  leukaemia
  Malignant mesothelioma
  Mantle cell lymphoma
  Melanoma
  Non-small-cell lung cancer
  Ovarian cancer
  Ovarian neoplasm
  Pancreatic acinar cell carcinoma
  Plasma cell myeloma
  Prostate carcinoma
  Psoriasis
  Small-cell lung cancer
  Testicular germ cell tumor
  Triple negative breast cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Head-neck squamous cell carcinoma
  Plasma cell neoplasm
  T-cell acute lymphoblastic leukaemia
  Anaplastic large cell lymphoma
  Breast cancer
  Multiple sclerosis
  Prostate cancer
  Squamous cell carcinoma
• UniProt ID: BCL10_HUMAN
• PDB ID: 2MB9; 6BZE; 6GK2; 8CZD; 8CZO
• Pfam ID: PF00619
• Sequence:
  MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTS
  SRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCS
  SCEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVG
  RTENTIFSSTTLPRPGDPGAPPLPPDLQLEEEGTCANSSEMFLPLRSRTVSRQ
• Function: Plays a key role in both adaptive and innate immune signaling by bridging CARD domain-containing proteins to immune activation. Acts by channeling adaptive and innate immune signaling downstream of CARD domain-containing proteins CARD9, CARD11 and CARD14 to activate NF-kappa-B and MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14) pathways which stimulate expression of genes encoding pro-inflammatory cytokines and chemokines. Recruited by activated CARD domain-containing proteins: homooligomerized CARD domain-containing proteins form a nucleating helical template that recruits BCL10 via CARD-CARD interaction, thereby promoting polymerization of BCL10, subsequent recruitment of MALT1 and formation of a CBM complex. This leads to activation of NF-kappa-B and MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14) pathways which stimulate expression of genes encoding pro-inflammatory cytokines and chemokines. Activated by CARD9 downstream of C-type lectin receptors; CARD9-mediated signals are essential for antifungal immunity. Activated by CARD11 downstream of T-cell receptor (TCR) and B-cell receptor (BCR). Promotes apoptosis, pro-caspase-9 maturation and activation of NF-kappa-B via NIK and IKK.
• Tissue Specificity: Ubiquitous.
• KEGG Pathway:
  NF-kappa B sig.ling pathway (hsa04064)
  C-type lectin receptor sig.ling pathway (hsa04625)
  T cell receptor sig.ling pathway (hsa04660)
  B cell receptor sig.ling pathway (hsa04662)
  Shigellosis (hsa05131)
  Tuberculosis (hsa05152)
• Reactome Pathway:
  Downstream TCR signaling (R-HSA-202424)
  FCERI mediated NF-kB activation (R-HSA-2871837)
  CLEC7A (Dectin-1) signaling (R-HSA-5607764)
  E3 ubiquitin ligases ubiquitinate target proteins (R-HSA-8866654)
  Activation of NF-kappaB in B cells (R-HSA-1169091)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cervical cancer	DISFSHPF	Definitive	Biomarker	[1]
Cervical carcinoma	DIST4S00	Definitive	Biomarker	[1]
Epithelial ovarian cancer	DIS56MH2	Definitive	Biomarker	[2]
Immunodeficiency 37	DISUEAF5	Definitive	Autosomal recessive	[3]
Lymphoma, non-Hodgkin, familial	DISCXYIZ	Definitive	Genetic Variation	[4]
Non-hodgkin lymphoma	DISS2Y8A	Definitive	Genetic Variation	[4]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[5]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[6]
Autoimmune disease	DISORMTM	Strong	Biomarker	[7]
Bladder cancer	DISUHNM0	Strong	Biomarker	[8]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[9]
Breast neoplasm	DISNGJLM	Strong	Posttranslational Modification	[10]
Carcinoma	DISH9F1N	Strong	Altered Expression	[11]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[12]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Biomarker	[13]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Genetic Variation	[14]
Colon cancer	DISVC52G	Strong	Altered Expression	[15]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[15]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[16]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[17]
Germ cell tumor	DIS62070	Strong	Genetic Variation	[18]
Glioma	DIS5RPEH	Strong	Altered Expression	[19]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[20]
Immunodeficiency	DIS093I0	Strong	Altered Expression	[21]
leukaemia	DISS7D1V	Strong	Altered Expression	[22]
Malignant mesothelioma	DISTHJGH	Strong	Altered Expression	[23]
Mantle cell lymphoma	DISFREOV	Strong	Biomarker	[24]
Melanoma	DIS1RRCY	Strong	Biomarker	[25]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[26]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[2]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[27]
Pancreatic acinar cell carcinoma	DISY1IQQ	Strong	Altered Expression	[28]
Plasma cell myeloma	DIS0DFZ0	Strong	Altered Expression	[29]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[30]
Psoriasis	DIS59VMN	Strong	Altered Expression	[31]
Small-cell lung cancer	DISK3LZD	Strong	Altered Expression	[32]
Testicular germ cell tumor	DIS5RN24	Strong	Genetic Variation	[18]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[33]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[8]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[8]
Head-neck squamous cell carcinoma	DISF7P24	moderate	Altered Expression	[34]
Plasma cell neoplasm	DIS2PJJM	moderate	Biomarker	[35]
T-cell acute lymphoblastic leukaemia	DIS17AI2	moderate	Biomarker	[36]
Anaplastic large cell lymphoma	DISP4D1R	Disputed	Altered Expression	[37]
Breast cancer	DIS7DPX1	Limited	Genetic Variation	[9]
Multiple sclerosis	DISB2WZI	Limited	Biomarker	[38]
Prostate cancer	DISF190Y	Limited	Altered Expression	[30]
Squamous cell carcinoma	DISQVIFL	Limited	Altered Expression	[39]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of B-cell lymphoma/leukemia 10 (BCL10).	[40]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of B-cell lymphoma/leukemia 10 (BCL10).	[41]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of B-cell lymphoma/leukemia 10 (BCL10).	[42]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of B-cell lymphoma/leukemia 10 (BCL10).	[43]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of B-cell lymphoma/leukemia 10 (BCL10).	[44]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of B-cell lymphoma/leukemia 10 (BCL10).	[45]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of B-cell lymphoma/leukemia 10 (BCL10).	[46]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of B-cell lymphoma/leukemia 10 (BCL10).	[47]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of B-cell lymphoma/leukemia 10 (BCL10).	[48]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of B-cell lymphoma/leukemia 10 (BCL10).	[48]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of B-cell lymphoma/leukemia 10 (BCL10).	[49]
DTI-015	DMXZRW0	Approved	DTI-015 increases the expression of B-cell lymphoma/leukemia 10 (BCL10).	[50]
Menthol	DMG2KW7	Approved	Menthol decreases the expression of B-cell lymphoma/leukemia 10 (BCL10).	[51]
Capsaicin	DMGMF6V	Approved	Capsaicin increases the expression of B-cell lymphoma/leukemia 10 (BCL10).	[52]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of B-cell lymphoma/leukemia 10 (BCL10).	[53]
Pelitinib	DMIW453	Phase 2	Pelitinib decreases the expression of B-cell lymphoma/leukemia 10 (BCL10).	[54]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of B-cell lymphoma/leukemia 10 (BCL10).	[55]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of B-cell lymphoma/leukemia 10 (BCL10).	[56]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of B-cell lymphoma/leukemia 10 (BCL10).	[57]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of B-cell lymphoma/leukemia 10 (BCL10).	[58]

References

• [1] Expression of BCL10 in cervical cancer has a role in the regulation of cell growth through the activation of NF-B-dependent cyclin D1 signaling.Gynecol Oncol. 2012 Aug;126(2):245-51. doi: 10.1016/j.ygyno.2012.04.047. Epub 2012 May 4.
• [2] Bcl-XL and MCL-1 constitute pertinent targets in ovarian carcinoma and their concomitant inhibition is sufficient to induce apoptosis.Int J Cancer. 2010 Feb 15;126(4):885-95. doi: 10.1002/ijc.24787.
• [3] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [4] Mutation of bcl-x gene in non-Hodgkin's lymphoma.Am J Hematol. 2002 Jan;69(1):74-6. doi: 10.1002/ajh.10030.
• [5] The anti-apoptotic genes Bcl-X(L) and Bcl-2 are over-expressed and contribute to chemoresistance of non-proliferating leukaemic CD34+ cells.Br J Haematol. 2002 Aug;118(2):521-34. doi: 10.1046/j.1365-2141.2002.03637.x.
• [6] Elevated expression of Bcl-X and reduced Bak in primary colorectal adenocarcinomas.Cancer Res. 1996 May 15;56(10):2422-7.
• [7] Bcl10 is required for the development and suppressive function of Foxp3(+) regulatory T cells.Cell Mol Immunol. 2021 Jan;18(1):206-218. doi: 10.1038/s41423-019-0297-y. Epub 2019 Oct 8.
• [8] Multitarget siRNA inhibition of antiapoptotic genes (XIAP, BCL2, BCL-X(L)) in bladder cancer cells.Anticancer Res. 2008 Jul-Aug;28(4B):2259-63.
• [9] The CARMA3-Bcl10-MALT1 Signalosome Drives NFB Activation and Promotes Aggressiveness in Angiotensin II Receptor-Positive Breast Cancer.Cancer Res. 2018 Mar 1;78(5):1225-1240. doi: 10.1158/0008-5472.CAN-17-1089. Epub 2017 Dec 19.
• [10] A pathway for tumor necrosis factor-alpha-induced Bcl10 nuclear translocation. Bcl10 is up-regulated by NF-kappaB and phosphorylated by Akt1 and then complexes with Bcl3 to enter the nucleus.J Biol Chem. 2006 Jan 6;281(1):167-75. doi: 10.1074/jbc.M511014200. Epub 2005 Nov 8.
• [11] Expression of PCNA, p53, Bax, and Bcl-X in oral poorly differentiated and basaloid squamous cell carcinoma: relationships with prognosis.Head Neck. 2005 Nov;27(11):982-9. doi: 10.1002/hed.20258.
• [12] Down-regulation of Bcl-XL by RNA interference suppresses cell growth and induces apoptosis in human esophageal cancer cells.World J Gastroenterol. 2006 Dec 14;12(46):7472-7. doi: 10.3748/wjg.v12.i46.7472.
• [13] The Bcl-2 homology domain 3 mimetic ABT-737 targets the apoptotic machinery in acute lymphoblastic leukemia resulting in synergistic in vitro and in vivo interactions with established drugs. Mol Pharmacol. 2010 Mar;77(3):483-94. doi: 10.1124/mol.109.060780. Epub 2009 Dec 28.
• [14] BCL10 in malignant lymphomas--an evaluation using fluorescence in situ hybridization.J Pathol. 2002 Jan;196(1):59-66. doi: 10.1002/path.1015.
• [15] Resistance of colon cancer cells to long-term 5-fluorouracil exposure is correlated to the relative level of Bcl-2 and Bcl-X(L) in addition to Bax and p53 status.Int J Cancer. 2002 Apr 1;98(4):498-504. doi: 10.1002/ijc.10146.
• [16] No evidence for BCL10 mutation in endometrial cancers with microsatellite instability.Hum Mutat. 2001 Feb;17(2):117-21. doi: 10.1002/1098-1004(200102)17:2<117::AID-HUMU3>3.0.CO;2-D.
• [17] Relationship between Egr-1 gene expression and apoptosis in esophageal carcinoma and precancerous lesions.World J Gastroenterol. 2002 Dec;8(6):971-5. doi: 10.3748/wjg.v8.i6.971.
• [18] Association of BCL10 germ line polymorphisms on chromosome 1p with advanced stage testicular germ cell tumor patients.Cancer Lett. 2006 Aug 18;240(1):41-7. doi: 10.1016/j.canlet.2005.08.019. Epub 2005 Oct 17.
• [19] ZNF436 promotes tumor cell proliferation through transcriptional activation of BCL10 in glioma.Biochem Biophys Res Commun. 2019 Aug 6;515(4):572-578. doi: 10.1016/j.bbrc.2019.06.004. Epub 2019 Jun 6.
• [20] Enhanced antitumor activity by combining an adenovirus harboring ING4 with cisplatin for hepatocarcinoma cells.Cancer Gene Ther. 2011 Mar;18(3):176-88. doi: 10.1038/cgt.2010.67. Epub 2010 Nov 5.
• [21] Changes in the level of apoptosis-related proteins in Jurkat cells infected with HIV-1 versus HIV-2.Mol Cell Biochem. 2010 Apr;337(1-2):175-83. doi: 10.1007/s11010-009-0297-9. Epub 2009 Oct 20.
• [22] Diversity of the apoptotic response to chemotherapy in childhood leukemia.Leukemia. 2002 Feb;16(2):223-32. doi: 10.1038/sj.leu.2402360.
• [23] Absence of post-transcriptional RNA modifications of BCL10 in human malignant mesothelioma and colorectal cancer.Genes Chromosomes Cancer. 2001 Jan;30(1):96-8. doi: 10.1002/1098-2264(2000)9999:9999<::aid-gcc1059>3.0.co;2-7.
• [24] B-cell receptor-driven MALT1 activity regulates MYC signaling in mantle cell lymphoma.Blood. 2017 Jan 19;129(3):333-346. doi: 10.1182/blood-2016-05-718775. Epub 2016 Nov 18.
• [25] Conditional expression of exogenous Bcl-X(S) triggers apoptosis in human melanoma cells in vitro and delays growth of melanoma xenografts.FEBS Lett. 2003 Oct 23;553(3):250-6. doi: 10.1016/s0014-5793(03)01017-2.
• [26] Mitochondrial inhibitor sensitizes non-small-cell lung carcinoma cells to TRAIL-induced apoptosis by reactive oxygen species and Bcl-X(L)/p53-mediated amplification mechanisms.Cell Death Dis. 2014 Dec 18;5(12):e1579. doi: 10.1038/cddis.2014.547.
• [27] Differential expression of Fas family members and Bcl-2 family members in benign versus malignant epithelial ovarian cancer (EOC) in North Indian population.Mol Cell Biochem. 2012 Sep;368(1-2):119-26. doi: 10.1007/s11010-012-1350-7. Epub 2012 Jun 12.
• [28] Cytological findings and BCL10 expression in pancreatic acinar cell carcinoma: A Case Report.Diagn Cytopathol. 2017 Mar;45(3):247-251. doi: 10.1002/dc.23634. Epub 2016 Nov 17.
• [29] Erucylphospho-N,N,N-trimethylpropylammonium (erufosine) is a potential antimyeloma drug devoid of myelotoxicity.Cancer Chemother Pharmacol. 2011 Jan;67(1):13-25. doi: 10.1007/s00280-010-1273-5. Epub 2010 Feb 23.
• [30] Apoptotic activity and mechanism of 2-cyano-3,12-dioxoolean-1,9-dien-28-oic-acid and related synthetic triterpenoids in prostate cancer.Cancer Res. 2008 Apr 15;68(8):2927-33. doi: 10.1158/0008-5472.CAN-07-5759.
• [31] CARD14-Mediated Activation of Paracaspase MALT1 in Keratinocytes: Implications for Psoriasis.J Invest Dermatol. 2017 Mar;137(3):569-575. doi: 10.1016/j.jid.2016.09.031. Epub 2016 Dec 8.
• [32] Non-receptor tyrosine kinase Etk is involved in the apoptosis of small cell lung cancer cells.Exp Mol Pathol. 2010 Jun;88(3):401-6. doi: 10.1016/j.yexmp.2010.02.003. Epub 2010 Mar 4.
• [33] A Human Genome-Wide RNAi Screen Reveals Diverse Modulators that Mediate IRE1-XBP1 Activation.Mol Cancer Res. 2018 May;16(5):745-753. doi: 10.1158/1541-7786.MCR-17-0307. Epub 2018 Feb 9.
• [34] Regulation of HPV16 E6 and MCL1 by SF3B1 inhibitor in head and neck cancer cells.Sci Rep. 2014 Aug 20;4:6098. doi: 10.1038/srep06098.
• [35] ABL-MYC retroviral infection elicits bone marrow plasma cell tumors in Bcl-X(L) transgenic mice.Leuk Res. 2005 Apr;29(4):435-44. doi: 10.1016/j.leukres.2004.09.007. Epub 2004 Dec 18.
• [36] Characteristics of CARMA1-BCL10-MALT1-A20-NF-B expression in T cell-acute lymphocytic leukemia.Eur J Med Res. 2014 Nov 11;19(1):62. doi: 10.1186/s40001-014-0062-8.
• [37] BCL10 down-regulation in peripheral T-cell lymphomas.Hum Pathol. 2012 Dec;43(12):2266-73. doi: 10.1016/j.humpath.2012.03.024. Epub 2012 Jul 19.
• [38] Elevated Bcl-X(L) levels correlate with T cell survival in multiple sclerosis.J Neuroimmunol. 2002 May;126(1-2):213-20. doi: 10.1016/s0165-5728(02)00067-x.
• [39] Similar BCL-X but different BCL-2 levels in the two age groups of north African nasopharyngeal carcinomas.Cancer Detect Prev. 2003;27(4):250-5. doi: 10.1016/s0361-090x(03)00098-9.
• [40] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [41] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [42] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [43] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [44] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [45] Genome-wide analysis of BEAS-2B cells exposed to trivalent arsenicals and dimethylthioarsinic acid. Toxicology. 2010 Jan 31;268(1-2):31-9.
• [46] Arsenic trioxide induces different gene expression profiles of genes related to growth and apoptosis in glioma cells dependent on the p53 status. Mol Biol Rep. 2008 Sep;35(3):421-9.
• [47] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [48] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [49] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [50] Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
• [51] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [52] Triggering of transient receptor potential vanilloid type 1 (TRPV1) by capsaicin induces Fas/CD95-mediated apoptosis of urothelial cancer cells in an ATM-dependent manner. Carcinogenesis. 2009 Aug;30(8):1320-9. doi: 10.1093/carcin/bgp138. Epub 2009 Jun 5.
• [53] Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
• [54] Irreversible EGFR inhibitor EKB-569 targets low-LET -radiation-triggered rel orchestration and potentiates cell death in squamous cell carcinoma. PLoS One. 2011;6(12):e29705. doi: 10.1371/journal.pone.0029705. Epub 2011 Dec 29.
• [55] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [56] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [57] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [58] Identification of genes associated with paraquat-induced toxicity in SH-SY5Y cells by PCR array focused on apoptotic pathways. J Toxicol Environ Health A. 2008;71(22):1457-67. doi: 10.1080/15287390802329364.