Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5ALRZ5)

• DOT Name: Polycystin-1 (PKD1)
• Synonyms: PC1; Autosomal dominant polycystic kidney disease 1 protein
• Gene Name: PKD1
• Related Disease:
  Autosomal dominant polycystic kidney disease
  Autosomal recessive polycystic kidney disease
  Chronic renal failure
  Neoplasm
  Polycystic kidney disease 1
  Acute myelogenous leukaemia
  Adult glioblastoma
  Angiomyolipoma
  Autosomal dominant polycystic liver disease
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Caroli disease
  Colorectal carcinoma
  Congestive heart failure
  Cystic fibrosis
  Cystic kidney disease
  End-stage renal disease
  Gastric cancer
  Glioblastoma multiforme
  High blood pressure
  Influenza
  Kidney failure
  Lung cancer
  Lung carcinoma
  Melanoma
  Nephropathy
  Non-small-cell lung cancer
  Osteosarcoma
  Polycystic kidney disease 2
  Polycystic kidney disease 3 with or without polycystic liver disease
  Polycystic liver disease 1
  Polycystic ovarian syndrome
  Prostate cancer
  Prostate carcinoma
  Stomach cancer
  Subarachnoid hemorrhage
  Triple negative breast cancer
  Tuberous sclerosis
  Chronic kidney disease
  Connective tissue disorder
  Glioma
  Marfan syndrome
  Metastatic malignant neoplasm
  Myocardial infarction
  Pancreatic cancer
  Parkinson disease
  Rheumatoid arthritis
  Tuberous sclerosis 2
  Type-1/2 diabetes
• UniProt ID: PKD1_HUMAN
• PDB ID: 1B4R; 6A70
• Pfam ID: PF00059 ; PF13855 ; PF00801 ; PF08016 ; PF01477 ; PF20519 ; PF02010 ; PF01822
• Sequence:
  MPPAAPARLALALGLGLWLGALAGGPGRGCGPCEPPCLCGPAPGAACRVNCSGRGLRTLG
  PALRIPADATALDVSHNLLRALDVGLLANLSALAELDISNNKISTLEEGIFANLFNLSEI
  NLSGNPFECDCGLAWLPRWAEEQQVRVVQPEAATCAGPGSLAGQPLLGIPLLDSGCGEEY
  VACLPDNSSGTVAAVSFSAAHEGLLQPEACSAFCFSTGQGLAALSEQGWCLCGAAQPSSA
  SFACLSLCSGPPPPPAPTCRGPTLLQHVFPASPGATLVGPHGPLASGQLAAFHIAAPLPV
  TATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEAAPAALE
  LVCPSSVQSDESLDLSIQNRGGSGLEAAYSIVALGEEPARAVHPLCPSDTEIFPGNGHCY
  RLVVEKAAWLQAQEQCQAWAGAALAMVDSPAVQRFLVSRVTRSLDVWIGFSTVQGVEVGP
  APQGEAFSLESCQNWLPGEPHPATAEHCVRLGPTGWCNTDLCSAPHSYVCELQPGGPVQD
  AENLLVGAPSGDLQGPLTPLAQQDGLSAPHEPVEVMVFPGLRLSREAFLTTAEFGTQELR
  RPAQLRLQVYRLLSTAGTPENGSEPESRSPDNRTQLAPACMPGGRWCPGANICLPLDASC
  HPQACANGCTSGPGLPGAPYALWREFLFSVPAGPPAQYSVTLHGQDVLMLPGDLVGLQHD
  AGPGALLHCSPAPGHPGPRAPYLSANASSWLPHLPAQLEGTWACPACALRLLAATEQLTV
  LLGLRPNPGLRLPGRYEVRAEVGNGVSRHNLSCSFDVVSPVAGLRVIYPAPRDGRLYVPT
  NGSALVLQVDSGANATATARWPGGSVSARFENVCPALVATFVPGCPWETNDTLFSVVALP
  WLSEGEHVVDVVVENSASRANLSLRVTAEEPICGLRATPSPEARVLQGVLVRYSPVVEAG
  SDMVFRWTINDKQSLTFQNVVFNVIYQSAAVFKLSLTASNHVSNVTVNYNVTVERMNRMQ
  GLQVSTVPAVLSPNATLALTAGVLVDSAVEVAFLWTFGDGEQALHQFQPPYNESFPVPDP
  SVAQVLVEHNVMHTYAAPGEYLLTVLASNAFENLTQQVPVSVRASLPSVAVGVSDGVLVA
  GRPVTFYPHPLPSPGGVLYTWDFGDGSPVLTQSQPAANHTYASRGTYHVRLEVNNTVSGA
  AAQADVRVFEELRGLSVDMSLAVEQGAPVVVSAAVQTGDNITWTFDMGDGTVLSGPEATV
  EHVYLRAQNCTVTVGAASPAGHLARSLHVLVFVLEVLRVEPAACIPTQPDARLTAYVTGN
  PAHYLFDWTFGDGSSNTTVRGCPTVTHNFTRSGTFPLALVLSSRVNRAHYFTSICVEPEV
  GNVTLQPERQFVQLGDEAWLVACAWPPFPYRYTWDFGTEEAAPTRARGPEVTFIYRDPGS
  YLVTVTASNNISAANDSALVEVQEPVLVTSIKVNGSLGLELQQPYLFSAVGRGRPASYLW
  DLGDGGWLEGPEVTHAYNSTGDFTVRVAGWNEVSRSEAWLNVTVKRRVRGLVVNASRTVV
  PLNGSVSFSTSLEAGSDVRYSWVLCDRCTPIPGGPTISYTFRSVGTFNIIVTAENEVGSA
  QDSIFVYVLQLIEGLQVVGGGRYFPTNHTVQLQAVVRDGTNVSYSWTAWRDRGPALAGSG
  KGFSLTVLEAGTYHVQLRATNMLGSAWADCTMDFVEPVGWLMVAASPNPAAVNTSVTLSA
  ELAGGSGVVYTWSLEEGLSWETSEPFTTHSFPTPGLHLVTMTAGNPLGSANATVEVDVQV
  PVSGLSIRASEPGGSFVAAGSSVPFWGQLATGTNVSWCWAVPGGSSKRGPHVTMVFPDAG
  TFSIRLNASNAVSWVSATYNLTAEEPIVGLVLWASSKVVAPGQLVHFQILLAAGSAVTFR
  LQVGGANPEVLPGPRFSHSFPRVGDHVVSVRGKNHVSWAQAQVRIVVLEAVSGLQVPNCC
  EPGIATGTERNFTARVQRGSRVAYAWYFSLQKVQGDSLVILSGRDVTYTPVAAGLLEIQV
  RAFNALGSENRTLVLEVQDAVQYVALQSGPCFTNRSAQFEAATSPSPRRVAYHWDFGDGS
  PGQDTDEPRAEHSYLRPGDYRVQVNASNLVSFFVAQATVTVQVLACREPEVDVVLPLQVL
  MRRSQRNYLEAHVDLRDCVTYQTEYRWEVYRTASCQRPGRPARVALPGVDVSRPRLVLPR
  LALPVGHYCFVFVVSFGDTPLTQSIQANVTVAPERLVPIIEGGSYRVWSDTRDLVLDGSE
  SYDPNLEDGDQTPLSFHWACVASTQREAGGCALNFGPRGSSTVTIPRERLAAGVEYTFSL
  TVWKAGRKEEATNQTVLIRSGRVPIVSLECVSCKAQAVYEVSRSSYVYLEGRCLNCSSGS
  KRGRWAARTFSNKTLVLDETTTSTGSAGMRLVLRRGVLRDGEGYTFTLTVLGRSGEEEGC
  ASIRLSPNRPPLGGSCRLFPLGAVHALTTKVHFECTGWHDAEDAGAPLVYALLLRRCRQG
  HCEEFCVYKGSLSSYGAVLPPGFRPHFEVGLAVVVQDQLGAAVVALNRSLAITLPEPNGS
  ATGLTVWLHGLTASVLPGLLRQADPQHVIEYSLALVTVLNEYERALDVAAEPKHERQHRA
  QIRKNITETLVSLRVHTVDDIQQIAAALAQCMGPSRELVCRSCLKQTLHKLEAMMLILQA
  ETTAGTVTPTAIGDSILNITGDLIHLASSDVRAPQPSELGAESPSRMVASQAYNLTSALM
  RILMRSRVLNEEPLTLAGEEIVAQGKRSDPRSLLCYGGAPGPGCHFSIPEAFSGALANLS
  DVVQLIFLVDSNPFPFGYISNYTVSTKVASMAFQTQAGAQIPIERLASERAITVKVPNNS
  DWAARGHRSSANSANSVVVQPQASVGAVVTLDSSNPAAGLHLQLNYTLLDGHYLSEEPEP
  YLAVYLHSEPRPNEHNCSASRRIRPESLQGADHRPYTFFISPGSRDPAGSYHLNLSSHFR
  WSALQVSVGLYTSLCQYFSEEDMVWRTEGLLPLEETSPRQAVCLTRHLTAFGASLFVPPS
  HVRFVFPEPTADVNYIVMLTCAVCLVTYMVMAAILHKLDQLDASRGRAIPFCGQRGRFKY
  EILVKTGWGRGSGTTAHVGIMLYGVDSRSGHRHLDGDRAFHRNSLDIFRIATPHSLGSVW
  KIRVWHDNKGLSPAWFLQHVIVRDLQTARSAFFLVNDWLSVETEANGGLVEKEVLAASDA
  ALLRFRRLLVAELQRGFFDKHIWLSIWDRPPRSRFTRIQRATCCVLLICLFLGANAVWYG
  AVGDSAYSTGHVSRLSPLSVDTVAVGLVSSVVVYPVYLAILFLFRMSRSKVAGSPSPTPA
  GQQVLDIDSCLDSSVLDSSFLTFSGLHAEQAFVGQMKSDLFLDDSKSLVCWPSGEGTLSW
  PDLLSDPSIVGSNLRQLARGQAGHGLGPEEDGFSLASPYSPAKSFSASDEDLIQQVLAEG
  VSSPAPTQDTHMETDLLSSLSSTPGEKTETLALQRLGELGPPSPGLNWEQPQAARLSRTG
  LVEGLRKRLLPAWCASLAHGLSLLLVAVAVAVSGWVGASFPPGVSVAWLLSSSASFLASF
  LGWEPLKVLLEALYFSLVAKRLHPDEDDTLVESPAVTPVSARVPRVRPPHGFALFLAKEE
  ARKVKRLHGMLRSLLVYMLFLLVTLLASYGDASCHGHAYRLQSAIKQELHSRAFLAITRS
  EELWPWMAHVLLPYVHGNQSSPELGPPRLRQVRLQEALYPDPPGPRVHTCSAAGGFSTSD
  YDVGWESPHNGSGTWAYSAPDLLGAWSWGSCAVYDSGGYVQELGLSLEESRDRLRFLQLH
  NWLDNRSRAVFLELTRYSPAVGLHAAVTLRLEFPAAGRALAALSVRPFALRRLSAGLSLP
  LLTSVCLLLFAVHFAVAEARTWHREGRWRVLRLGAWARWLLVALTAATALVRLAQLGAAD
  RQWTRFVRGRPRRFTSFDQVAQLSSAARGLAASLLFLLLVKAAQQLRFVRQWSVFGKTLC
  RALPELLGVTLGLVVLGVAYAQLAILLVSSCVDSLWSVAQALLVLCPGTGLSTLCPAESW
  HLSPLLCVGLWALRLWGALRLGAVILRWRYHALRGELYRPAWEPQDYEMVELFLRRLRLW
  MGLSKVKEFRHKVRFEGMEPLPSRSSRGSKVSPDVPPPSAGSDASHPSTSSSQLDGLSVS
  LGRLGTRCEPEPSRLQAVFEALLTQFDRLNQATEDVYQLEQQLHSLQGRRSSRAPAGSSR
  GPSPGLRPALPSRLARASRGVDLATGPSRTPLRAKNKVHPSST
• Function: Component of a heteromeric calcium-permeable ion channel formed by PKD1 and PKD2 that is activated by interaction between PKD1 and a Wnt family member, such as WNT3A and WNT9B. Both PKD1 and PKD2 are required for channel activity. Involved in renal tubulogenesis. Involved in fluid-flow mechanosensation by the primary cilium in renal epithelium. Acts as a regulator of cilium length, together with PKD2. The dynamic control of cilium length is essential in the regulation of mechanotransductive signaling. The cilium length response creates a negative feedback loop whereby fluid shear-mediated deflection of the primary cilium, which decreases intracellular cAMP, leads to cilium shortening and thus decreases flow-induced signaling. May be an ion-channel regulator. Involved in adhesive protein-protein and protein-carbohydrate interactions. Likely to be involved with polycystin-1-interacting protein 1 in the detection, sequestration and exocytosis of senescent mitochondria.
• Reactome Pathway: VxPx cargo-targeting to cilium (R-HSA-5620916)

Molecular Interaction Atlas (MIA) of This DOT

51 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Autosomal dominant polycystic kidney disease	DISBHWUI	Definitive	Autosomal dominant	[1]
Autosomal recessive polycystic kidney disease	DISPUS40	Definitive	Autosomal recessive	[1]
Chronic renal failure	DISGG7K6	Definitive	Genetic Variation	[2]
Neoplasm	DISZKGEW	Definitive	Biomarker	[3]
Polycystic kidney disease 1	DIS9FB3R	Definitive	Autosomal dominant	[4]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[5]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[6]
Angiomyolipoma	DIS2L71N	Strong	Genetic Variation	[7]
Autosomal dominant polycystic liver disease	DISJS005	Strong	Biomarker	[8]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[9]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[10]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[10]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[11]
Caroli disease	DISXQYMX	Strong	Autosomal dominant	[4]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[12]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[13]
Cystic fibrosis	DIS2OK1Q	Strong	Genetic Variation	[14]
Cystic kidney disease	DISRT1LM	Strong	Biomarker	[15]
End-stage renal disease	DISXA7GG	Strong	Genetic Variation	[2]
Gastric cancer	DISXGOUK	Strong	Posttranslational Modification	[16]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[6]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[17]
Influenza	DIS3PNU3	Strong	Genetic Variation	[18]
Kidney failure	DISOVQ9P	Strong	Genetic Variation	[19]
Lung cancer	DISCM4YA	Strong	Biomarker	[20]
Lung carcinoma	DISTR26C	Strong	Biomarker	[20]
Melanoma	DIS1RRCY	Strong	Biomarker	[21]
Nephropathy	DISXWP4P	Strong	Biomarker	[22]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[23]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[9]
Polycystic kidney disease 2	DIS4UQIF	Strong	Genetic Variation	[24]
Polycystic kidney disease 3 with or without polycystic liver disease	DISYK31B	Strong	Genetic Variation	[25]
Polycystic liver disease 1	DIS52T2A	Strong	Biomarker	[26]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[27]
Prostate cancer	DISF190Y	Strong	Altered Expression	[28]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[28]
Stomach cancer	DISKIJSX	Strong	Posttranslational Modification	[16]
Subarachnoid hemorrhage	DISI7I8Y	Strong	Genetic Variation	[29]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[30]
Tuberous sclerosis	DISEMUGZ	Strong	Genetic Variation	[7]
Chronic kidney disease	DISW82R7	moderate	Biomarker	[31]
Connective tissue disorder	DISKXBS3	Limited	Biomarker	[32]
Glioma	DIS5RPEH	Limited	Biomarker	[33]
Marfan syndrome	DISVEUWZ	Limited	Genetic Variation	[34]
Metastatic malignant neoplasm	DIS86UK6	Limited	Altered Expression	[3]
Myocardial infarction	DIS655KI	Limited	Genetic Variation	[35]
Pancreatic cancer	DISJC981	Limited	Altered Expression	[36]
Parkinson disease	DISQVHKL	Limited	Biomarker	[37]
Rheumatoid arthritis	DISTSB4J	Limited	Altered Expression	[38]
Tuberous sclerosis 2	DISR6GKZ	Limited	Biomarker	[5]
Type-1/2 diabetes	DISIUHAP	Limited	Genetic Variation	[17]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Polycystin-1 (PKD1).	[39]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Polycystin-1 (PKD1).	[40]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Polycystin-1 (PKD1).	[41]
Selenium	DM25CGV	Approved	Selenium increases the expression of Polycystin-1 (PKD1).	[43]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Polycystin-1 (PKD1).	[44]
Sulindac	DM2QHZU	Approved	Sulindac increases the expression of Polycystin-1 (PKD1).	[45]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Polycystin-1 (PKD1).	[46]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Polycystin-1 (PKD1).	[43]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of Polycystin-1 (PKD1).	[47]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Polycystin-1 (PKD1).	[42]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Genetic Characteristics of Korean Patients with Autosomal Dominant Polycystic Kidney Disease by Targeted Exome Sequencing.Sci Rep. 2019 Nov 18;9(1):16952. doi: 10.1038/s41598-019-52474-1.
• [3] Analysis of oncogenic activities of protein kinase D1 in head and neck squamous cell carcinoma.BMC Cancer. 2018 Nov 12;18(1):1107. doi: 10.1186/s12885-018-4965-6.
• [4] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [5] Insight into response to mTOR inhibition when PKD1 and TSC2 are mutated.BMC Med Genet. 2015 Jun 17;16:39. doi: 10.1186/s12881-015-0185-y.
• [6] Polycystin-1 affects cancer cell behaviour and interacts with mTOR and Jak signalling pathways in cancer cell lines.J Cell Mol Med. 2019 Sep;23(9):6215-6227. doi: 10.1111/jcmm.14506. Epub 2019 Jun 28.
• [7] Renal disease in tuberous sclerosis complex: pathogenesis and therapy.Nat Rev Nephrol. 2018 Nov;14(11):704-716. doi: 10.1038/s41581-018-0059-6.
• [8] ALG9 Mutation Carriers Develop Kidney and Liver Cysts. J Am Soc Nephrol. 2019 Nov;30(11):2091-2102. doi: 10.1681/ASN.2019030298. Epub 2019 Aug 8.
• [9] PKD1 negatively regulates cell invasion, migration and proliferation ability of human osteosarcoma.Int J Oncol. 2012 Jun;40(6):1839-48. doi: 10.3892/ijo.2012.1400. Epub 2012 Mar 12.
• [10] Oncogenic functions of protein kinase D2 and D3 in regulating multiple cancer-related pathways in breast cancer.Cancer Med. 2019 Feb;8(2):729-741. doi: 10.1002/cam4.1938. Epub 2019 Jan 16.
• [11] The phosphorylation status of PIP5K1C at serine 448 can be predictive for invasive ductal carcinoma of the breast.Oncotarget. 2018 Nov 20;9(91):36358-36370. doi: 10.18632/oncotarget.26357. eCollection 2018 Nov 20.
• [12] Polycystin-1 and polycystin-2 are involved in the acquisition of aggressive phenotypes in colorectal cancer.Int J Cancer. 2015 Apr 1;136(7):1515-27. doi: 10.1002/ijc.29140. Epub 2014 Sep 3.
• [13] Protein kinase D isoforms are activated in an agonist-specific manner in cardiomyocytes.J Biol Chem. 2011 Feb 25;286(8):6500-9. doi: 10.1074/jbc.M110.208058. Epub 2010 Dec 14.
• [14] Autosomal dominant polycystic kidney disease coexisting with cystic fibrosis.J Nephrol. 2006 Jul-Aug;19(4):529-34.
• [15] The role of DNA damage as a therapeutic target in autosomal dominant polycystic kidney disease.Expert Rev Mol Med. 2019 Nov 26;21:e6. doi: 10.1017/erm.2019.6.
• [16] Epigenetic inactivation of protein kinase D1 in gastric cancer and its role in gastric cancer cell migration and invasion.Carcinogenesis. 2008 Mar;29(3):629-37. doi: 10.1093/carcin/bgm291. Epub 2008 Feb 17.
• [17] The association of endothelin-1 levels with renal survival in polycystic kidney disease patients.J Nephrol. 2019 Feb;32(1):83-91. doi: 10.1007/s40620-018-0514-2. Epub 2018 Jul 18.
• [18] Molecular diagnosis and characterization of a culture-negative mycotic aneurysm due to ST54 Haemophilus influenzae type b with PBP 3 alterations.J Infect Chemother. 2018 Jul;24(7):570-572. doi: 10.1016/j.jiac.2017.12.013. Epub 2018 Jan 17.
• [19] Pkd1-targeted mutation reveals a role for the Wolffian duct in autosomal dominant polycystic kidney disease.J Dev Orig Health Dis. 2020 Feb;11(1):78-85. doi: 10.1017/S2040174419000436. Epub 2019 Aug 15.
• [20] Data-driven Analysis of TRP Channels in Cancer: Linking Variation in Gene Expression to Clinical Significance.Cancer Genomics Proteomics. 2016 Jan-Feb;13(1):83-90.
• [21] Cloning, chromosomal localization, and tissue expression of autotaxin from human teratocarcinoma cells.Biochem Biophys Res Commun. 1996 Jan 26;218(3):714-9. doi: 10.1006/bbrc.1996.0127.
• [22] Caffeine Accelerates Cystic Kidney Disease in a Pkd1-Deficient Mouse Model.Cell Physiol Biochem. 2019;52(5):1061-1074. doi: 10.33594/000000072.
• [23] PKD1 is downregulated in non-small cell lung cancer and mediates the feedback inhibition of mTORC1-S6K1 axis in response to phorbol ester.Int J Biochem Cell Biol. 2015 Mar;60:34-42. doi: 10.1016/j.biocel.2014.12.018. Epub 2015 Jan 9.
• [24] Regulation of KLF12 by microRNA-20b and microRNA-106a in cystogenesis.FASEB J. 2018 Jul;32(7):3574-3582. doi: 10.1096/fj.201700923R. Epub 2018 Feb 16.
• [25] Diagnosis of autosomal dominant polycystic kidney disease using efficient PKD1 and PKD2 targeted next-generation sequencing.Mol Genet Genomic Med. 2014 Sep;2(5):412-21. doi: 10.1002/mgg3.82. Epub 2014 May 23.
• [26] Histone deacetylase 6 inhibition reduces cysts by decreasing cAMP and Ca(2+) in knock-out mouse models of polycystic kidney disease.J Biol Chem. 2017 Oct 27;292(43):17897-17908. doi: 10.1074/jbc.M117.803775. Epub 2017 Sep 8.
• [27] Association of genetic polymorphism of PC-1 gene (rs1044498 Lys121Gln) with insulin-resistant type 2 diabetes mellitus in Punjabi Population of Pakistan.Mol Genet Genomic Med. 2019 Aug;7(8):e775. doi: 10.1002/mgg3.775. Epub 2019 Jun 28.
• [28] Protein kinase D1 regulates subcellular localisation and metastatic function of metastasis-associated protein 1.Br J Cancer. 2018 Feb 20;118(4):587-599. doi: 10.1038/bjc.2017.431. Epub 2018 Feb 20.
• [29] An autopsy case of subarachnoid hemorrhage due to ruptured cerebral aneurysm associated with polycystic kidney disease caused by a novel PKD1 mutation.Forensic Sci Int. 2014 Sep;242:e18-e21. doi: 10.1016/j.forsciint.2014.06.029. Epub 2014 Jul 2.
• [30] PKD1 is a potential biomarker and therapeutic target in triple-negative breast cancer.Oncotarget. 2018 May 1;9(33):23208-23219. doi: 10.18632/oncotarget.25292. eCollection 2018 May 1.
• [31] Alternative splicing events is not a key event for gene expression regulation in uremia.PLoS One. 2013 Dec 16;8(12):e82702. doi: 10.1371/journal.pone.0082702. eCollection 2013.
• [32] Mutations in multiple PKD genes may explain early and severe polycystic kidney disease.J Am Soc Nephrol. 2011 Nov;22(11):2047-56. doi: 10.1681/ASN.2010101080. Epub 2011 Oct 27.
• [33] Identification of genes that modulate sensitivity of U373MG glioblastoma cells to cis-platinum.Anticancer Drugs. 2006 Aug;17(7):733-51. doi: 10.1097/01.cad.0000217429.67455.18.
• [34] A Pkd1-Fbn1 genetic interaction implicates TGF- signaling in the pathogenesis of vascular complications in autosomal dominant polycystic kidney disease.J Am Soc Nephrol. 2014 Jan;25(1):81-91. doi: 10.1681/ASN.2012050486. Epub 2013 Sep 26.
• [35] Induced pluripotent stem cells derived from an autosomal dominant polycystic kidney disease patient carrying a PKD1 Q533X mutation.Stem Cell Res. 2017 Dec;25:83-87. doi: 10.1016/j.scr.2017.10.026. Epub 2017 Oct 28.
• [36] Protein kinase D1 regulates metabolic switch in pancreatic cancer via modulation of mTORC1.Br J Cancer. 2020 Jan;122(1):121-131. doi: 10.1038/s41416-019-0629-9. Epub 2019 Dec 10.
• [37] Peripheral assessment of the genes AQP4, PBP and TH in patients with Parkinson's disease.Neurochem Res. 2012 Mar;37(3):512-5. doi: 10.1007/s11064-011-0637-5. Epub 2011 Nov 15.
• [38] IL-1 beta- and IL-4-induced down-regulation of autotaxin mRNA and PC-1 in fibroblast-like synoviocytes of patients with rheumatoid arthritis (RA).Clin Exp Immunol. 2001 Jan;123(1):147-54. doi: 10.1046/j.1365-2249.2001.01432.x.
• [39] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [40] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [41] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [42] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [43] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [44] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [45] Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
• [46] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [47] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.