Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5WTJ2M)

DOT Name	L-serine dehydratase/L-threonine deaminase (SDS)
Synonyms	SDH; EC 4.3.1.17; L-serine deaminase; L-threonine dehydratase; TDH; EC 4.3.1.19
Gene Name	SDS
Related Disease	Type-1 diabetes ( ) Acute myelogenous leukaemia ( ) Acute myocardial infarction ( ) Advanced cancer ( ) Alzheimer disease ( ) Amyloidosis ( ) Bladder cancer ( ) Breast cancer ( ) Cardiomyopathy ( ) Chronic kidney disease ( ) Chronic obstructive pulmonary disease ( ) Cowden disease ( ) Dementia ( ) Depression ( ) Hereditary leiomyomatosis and renal cell cancer ( ) High blood pressure ( ) Inflammatory bowel disease ( ) Influenza ( ) Kidney cancer ( ) Major depressive disorder ( ) Mitochondrial disease ( ) Neoplasm ( ) Neuroblastoma ( ) Paraganglioma ( ) Pheochromocytoma ( ) Renal carcinoma ( ) Renal cell carcinoma ( ) Subarachnoid hemorrhage ( ) Systemic lupus erythematosus ( ) Thyroid cancer ( ) Thyroid gland carcinoma ( ) Thyroid tumor ( ) Triple negative breast cancer ( ) Tuberculosis ( ) Urinary bladder cancer ( ) Urinary bladder neoplasm ( ) Von hippel-lindau disease ( ) Hepatocellular carcinoma ( ) Kidney neoplasm ( ) Obesity ( ) Chromosomal disorder ( ) Clear cell renal carcinoma ( ) Matthew-Wood syndrome ( ) Pancreatic ductal carcinoma ( )
UniProt ID	SDHL_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1P5J; 4H27
EC Number	4.3.1.17; 4.3.1.19
Pfam ID	PF00291
Sequence	MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHF VCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA KALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGL QEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGAQALKLFQEHP IFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEGNLRTPLPSLVV IVCGGSNISLAQLRALKEQLGMTNRLPK
KEGG Pathway	Glycine, serine and threonine metabolism (hsa00260 ) Cysteine and methionine metabolism (hsa00270 ) Valine, leucine and isoleucine biosynthesis (hsa00290 ) Metabolic pathways (hsa01100 ) Carbon metabolism (hsa01200 ) Biosynthesis of amino acids (hsa01230 )
Reactome Pathway	Threonine catabolism (R-HSA-8849175 )
BioCyc Pathway	MetaCyc:HS05952-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Type-1 diabetes	DIS7HLUB	Definitive	Biomarker	[1]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[2]
Acute myocardial infarction	DISE3HTG	Strong	Genetic Variation	[3]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[4]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[5]
Amyloidosis	DISHTAI2	Strong	Biomarker	[6]
Bladder cancer	DISUHNM0	Strong	Genetic Variation	[7]
Breast cancer	DIS7DPX1	Strong	Biomarker	[8]
Cardiomyopathy	DISUPZRG	Strong	Genetic Variation	[9]
Chronic kidney disease	DISW82R7	Strong	Biomarker	[10]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Altered Expression	[11]
Cowden disease	DISMYKCE	Strong	Genetic Variation	[8]
Dementia	DISXL1WY	Strong	Biomarker	[12]
Depression	DIS3XJ69	Strong	Biomarker	[13]
Hereditary leiomyomatosis and renal cell cancer	DISN22G2	Strong	Biomarker	[14]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[15]
Inflammatory bowel disease	DISGN23E	Strong	Genetic Variation	[16]
Influenza	DIS3PNU3	Strong	Biomarker	[17]
Kidney cancer	DISBIPKM	Strong	Biomarker	[18]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[19]
Mitochondrial disease	DISKAHA3	Strong	Biomarker	[20]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[4]
Neuroblastoma	DISVZBI4	Strong	Biomarker	[21]
Paraganglioma	DIS2XXH5	Strong	Genetic Variation	[4]
Pheochromocytoma	DIS56IFV	Strong	Genetic Variation	[4]
Renal carcinoma	DISER9XT	Strong	Biomarker	[18]
Renal cell carcinoma	DISQZ2X8	Strong	Genetic Variation	[22]
Subarachnoid hemorrhage	DISI7I8Y	Strong	Biomarker	[23]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[24]
Thyroid cancer	DIS3VLDH	Strong	Genetic Variation	[8]
Thyroid gland carcinoma	DISMNGZ0	Strong	Genetic Variation	[8]
Thyroid tumor	DISLVKMD	Strong	Genetic Variation	[8]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[25]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[26]
Urinary bladder cancer	DISDV4T7	Strong	Genetic Variation	[7]
Urinary bladder neoplasm	DIS7HACE	Strong	Genetic Variation	[7]
Von hippel-lindau disease	DIS6ZFQQ	Strong	Biomarker	[27]
Hepatocellular carcinoma	DIS0J828	moderate	Biomarker	[28]
Kidney neoplasm	DISBNZTN	moderate	Biomarker	[29]
Obesity	DIS47Y1K	moderate	Biomarker	[30]
Chromosomal disorder	DISM5BB5	Limited	Biomarker	[31]
Clear cell renal carcinoma	DISBXRFJ	Limited	Genetic Variation	[22]
Matthew-Wood syndrome	DISA7HR7	Limited	Biomarker	[32]
Pancreatic ductal carcinoma	DIS26F9Q	Limited	Biomarker	[32]
------------------------------------------------------------------------------------


⏷ Show the Full List of 44 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Zidovudine	DM4KI7O	Approved	L-serine dehydratase/L-threonine deaminase (SDS) increases the Cell-mediated cytotoxicity ADR of Zidovudine.	[41]
Zalcitabine	DMH7MUV	Approved	L-serine dehydratase/L-threonine deaminase (SDS) increases the Cell-mediated cytotoxicity ADR of Zalcitabine.	[41]
Didanosine	DMI2QPE	Approved	L-serine dehydratase/L-threonine deaminase (SDS) increases the Cell-mediated cytotoxicity ADR of Didanosine.	[41]
------------------------------------------------------------------------------------

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of L-serine dehydratase/L-threonine deaminase (SDS).	[33]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of L-serine dehydratase/L-threonine deaminase (SDS).	[34]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of L-serine dehydratase/L-threonine deaminase (SDS).	[35]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of L-serine dehydratase/L-threonine deaminase (SDS).	[36]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of L-serine dehydratase/L-threonine deaminase (SDS).	[37]
Aspirin	DM672AH	Approved	Aspirin increases the expression of L-serine dehydratase/L-threonine deaminase (SDS).	[38]
PMID28870136-Compound-48	DMPIM9L	Patented	PMID28870136-Compound-48 increases the expression of L-serine dehydratase/L-threonine deaminase (SDS).	[40]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Drug(s)

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of L-serine dehydratase/L-threonine deaminase (SDS).	[39]
------------------------------------------------------------------------------------

References

1	Efficacy of Growth Hormone Treatment in Children with Type 1 Diabetes Mellitus and Growth Hormone Deficiency-An Analysis of KIGS Data.J Pediatr. 2018 Jul;198:260-264. doi: 10.1016/j.jpeds.2018.02.035. Epub 2018 Apr 12.
2	A new and efficient carboxymethyl-hexanoyl chitosan/dodecyl sulfate nanocarrier for a pyrazoline with antileukemic activity.Mater Sci Eng C Mater Biol Appl. 2019 Dec;105:110051. doi: 10.1016/j.msec.2019.110051. Epub 2019 Aug 19.
3	Identification and Characterization of Cardiac Troponin T Fragments in Serum of Patients Suffering from Acute Myocardial Infarction.Clin Chem. 2017 Feb;63(2):563-572. doi: 10.1373/clinchem.2016.261511. Epub 2016 Dec 9.
4	Imaging Features of Succinate Dehydrogenase-deficient Pheochromocytoma-Paraganglioma Syndromes.Radiographics. 2019 Sep-Oct;39(5):1393-1410. doi: 10.1148/rg.2019180151.
5	Abnormalities of DYRK1A-Cytoskeleton Complexes in the Blood Cells as Potential Biomarkers of Alzheimer's Disease.J Alzheimers Dis. 2019;72(4):1059-1075. doi: 10.3233/JAD-190475.
6	Bacterial Amyloids: Biogenesis and Biomaterials.Adv Exp Med Biol. 2019;1174:113-159. doi: 10.1007/978-981-13-9791-2_4.
7	Identification and validation of suitable endogenous reference genes for gene expression studies of human bladder cancer.J Urol. 2006 May;175(5):1915-20. doi: 10.1016/S0022-5347(05)00919-5.
8	Germline SDHx variants modify breast and thyroid cancer risks in Cowden and Cowden-like syndrome via FAD/NAD-dependant destabilization of p53. Hum Mol Genet. 2012 Jan 15;21(2):300-10. doi: 10.1093/hmg/ddr459. Epub 2011 Oct 6.
9	Recessive germline SDHA and SDHB mutations causing leukodystrophy and isolated mitochondrial complex II deficiency. J Med Genet. 2012 Sep;49(9):569-77. doi: 10.1136/jmedgenet-2012-101146.
10	Catch-up growth in children with chronic kidney disease started on enteral feeding after 2 years of age.Pediatr Nephrol. 2020 Jan;35(1):113-118. doi: 10.1007/s00467-019-04382-9. Epub 2019 Oct 24.
11	IL-13-driven pulmonary emphysema leads to skeletal muscle dysfunction attenuated by endurance exercise.J Appl Physiol (1985). 2020 Jan 1;128(1):134-148. doi: 10.1152/japplphysiol.00627.2019. Epub 2019 Nov 27.
12	Increase in brain atrophy after subdural hematoma to rates greater than associated with dementia.J Neurosurg. 2018 Dec 1;129(6):1579-1587. doi: 10.3171/2017.8.JNS17477.
13	Relationship between work functioning and self-reported cognitive complaints in patients with major depressive disorder treated with desvenlafaxine.Psychiatry Res. 2019 Feb;272:144-148. doi: 10.1016/j.psychres.2018.12.062. Epub 2018 Dec 10.
14	Krebs-cycle-deficient hereditary cancer syndromes are defined by defects in homologous-recombination DNA repair. Nat Genet. 2018 Aug;50(8):1086-1092. doi: 10.1038/s41588-018-0170-4. Epub 2018 Jul 16.
15	What has changed in the prevalence of hypertension in dialyzed children during the last decade?.Ren Fail. 2017 Nov;39(1):283-289. doi: 10.1080/0886022X.2016.1260033. Epub 2016 Nov 24.
16	Inflammatory bowel disease in Shwachman-Diamond syndrome; is there an association?.Clin Res Hepatol Gastroenterol. 2020 Feb;44(1):e10-e13. doi: 10.1016/j.clinre.2019.05.006. Epub 2019 Jun 10.
17	Comparison of single radial immunodiffusion, SDS-PAGE and HPLC potency assays for inactivated influenza vaccines shows differences in ability to predict immunogenicity of haemagglutinin antigen.Vaccine. 2018 Jul 5;36(29):4339-4345. doi: 10.1016/j.vaccine.2018.05.076. Epub 2018 Jun 9.
18	Urological cancer related to familial syndromes.Int Braz J Urol. 2017 Mar-Apr;43(2):192-201. doi: 10.1590/S1677-5538.IBJU.2016.0125.
19	The screen for cognitive impairment in psychiatry (SCIP) is associated with disease severity and cognitive complaints in major depression.Int J Psychiatry Clin Pract. 2019 Mar;23(1):49-56. doi: 10.1080/13651501.2018.1450512. Epub 2018 Mar 19.
20	Ultrastructural examination of skin biopsies may assist in diagnosing mitochondrial cytopathy when muscle biopsies yield negative results.Ann Diagn Pathol. 2017 Aug;29:41-45. doi: 10.1016/j.anndiagpath.2017.02.010. Epub 2017 Apr 28.
21	Free radicals impair the anti-oxidative stress activity of DJ-1 through the formation of SDS-resistant dimer.Free Radic Res. 2017 Apr;51(4):397-412. doi: 10.1080/10715762.2017.1324201.
22	The Impact Of Succinate Dehydrogenase Gene (SDH) Mutations In Renal Cell Carcinoma (RCC): A Systematic Review.Onco Targets Ther. 2019 Sep 26;12:7929-7940. doi: 10.2147/OTT.S207460. eCollection 2019.
23	Aneurysmal Subarachnoid Hemorrhage with Spinal Subdural Hematoma: A Case Report and Systematic Review of the Literature.World Neurosurg. 2019 Aug;128:240-247. doi: 10.1016/j.wneu.2019.05.069. Epub 2019 May 17.
24	Decellularized liver transplant could be recellularized in rat partial hepatectomy model.J Biomed Mater Res A. 2019 Nov;107(11):2576-2588. doi: 10.1002/jbm.a.36763. Epub 2019 Aug 9.
25	Proteomic investigation on bio-corona of Au, Ag and Fe nanoparticles for the discovery of triple negative breast cancer serum protein biomarkers.J Proteomics. 2020 Feb 10;212:103581. doi: 10.1016/j.jprot.2019.103581. Epub 2019 Nov 12.
26	Differential thermal stability, conformational stability and unfolding behavior of Eis proteins from Mycobacterium smegmatis and Mycobacterium tuberculosis.PLoS One. 2019 Mar 25;14(3):e0213933. doi: 10.1371/journal.pone.0213933. eCollection 2019.
27	Isocitrate dehydrogenase mutations are rare in pheochromocytomas and paragangliomas.J Clin Endocrinol Metab. 2010 Mar;95(3):1274-8. doi: 10.1210/jc.2009-2170. Epub 2009 Nov 13.
28	Induction of Apoptosis by Tithonia diversifolia in Human Hepatoma Cells.Pharmacogn Mag. 2017 Oct-Dec;13(52):702-706. doi: 10.4103/0973-1296.218113. Epub 2017 Nov 13.
29	Succinate Dehydrogenase (SDH)-Deficient Pancreatic Neuroendocrine Tumor Expands the SDH-Related Tumor Spectrum.J Clin Endocrinol Metab. 2015 Oct;100(10):E1386-93. doi: 10.1210/jc.2015-2689. Epub 2015 Aug 10.
30	Maternal pre-pregnancy body mass index, smoking in pregnancy, and alcohol intake in pregnancy in relation to pubertal timing in the children.BMC Pediatr. 2019 Sep 16;19(1):338. doi: 10.1186/s12887-019-1715-0.
31	Toxicological responses of surfactant functionalized selenium nanoparticles: A quantitative multi-assay approach.Sci Total Environ. 2018 Dec 1;643:1265-1277. doi: 10.1016/j.scitotenv.2018.06.296. Epub 2018 Jul 4.
32	Clinically approved PEGylated nanoparticles are covered by a protein corona that boosts the uptake by cancer cells.Nanoscale. 2017 Jul 27;9(29):10327-10334. doi: 10.1039/c7nr03042h.
33	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
34	Retinoic acid-induced downmodulation of telomerase activity in human cancer cells. Exp Mol Pathol. 2005 Oct;79(2):108-17.
35	Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
36	Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
37	The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
38	Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
39	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
40	Global expression profiling of theophylline response genes in macrophages: evidence of airway anti-inflammatory regulation. Respir Res. 2005 Aug 8;6(1):89. doi: 10.1186/1465-9921-6-89.
41	ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.