Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT62ZU6B)

DOT Name Small proline-rich protein 2A (SPRR2A)
Synonyms SPR-2A; 2-1
Gene Name SPRR2A
Related Disease
Arthritis ( )
OPTN-related open angle glaucoma ( )
Amyloidosis ( )
Anal cancer ( )
Anus cancer ( )
Beta thalassemia ( )
Breast carcinoma ( )
Cholangiocarcinoma ( )
Craniosynostosis ( )
Esophageal squamous cell carcinoma ( )
Essential hypertension ( )
Factor IX deficiency ( )
Familial Alzheimer disease ( )
Haemophilia A ( )
Hepatitis C virus infection ( )
Hereditary nonpolyposis colon cancer ( )
Hereditary spherocytosis ( )
Herpes simplex infection ( )
High blood pressure ( )
Inherited bleeding disorder, platelet-type ( )
Metastatic malignant neoplasm ( )
Myocardial infarction ( )
Neoplasm ( )
Non-alcoholic fatty liver disease ( )
Non-insulin dependent diabetes ( )
Von Willebrand disease 2 ( )
Chronic otitis media ( )
Head-neck squamous cell carcinoma ( )
Methicillin-resistant staphylococci infection ( )
Type-1/2 diabetes ( )
Bladder cancer ( )
Breast cancer ( )
Gastric cancer ( )
Gastric neoplasm ( )
Glaucoma/ocular hypertension ( )
Hereditary diffuse gastric adenocarcinoma ( )
Keratoconjunctivitis sicca ( )
Ocular hypertension ( )
Sickle-cell anaemia ( )
Sjogren syndrome ( )
Type-1 diabetes ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
UniProt ID
SPR2A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF14820
Sequence
MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPS
PPCQSKYPPKSK
Function
Gut bactericidal protein that selectively kills Gram-positive bacteria by binding to negatively charged lipids on bacterial membranes, leading to bacterial membrane permeabilization and disruption. Specifically binds lipids bearing negatively charged headgroups, such as phosphatidic acid, phosphatidylserine (PS), cardiolipin (CL), and phosphatidylinositol phosphates, but not to zwitterionic or neutral lipids. Induced by type-2 cytokines in response to helminth infection and is required to protect against helminth-induced bacterial invasion of intestinal tissue. May also be involved in the development of the cornified envelope of squamous epithelia; however, additional evidences are required to confirm this result in vivo.
Tissue Specificity Expressed in intestine; selectively expressed in goblet cells.
Reactome Pathway
Formation of the cornified envelope (R-HSA-6809371 )

Molecular Interaction Atlas (MIA) of This DOT

43 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Arthritis DIST1YEL Definitive Biomarker [1]
OPTN-related open angle glaucoma DISDR98A Definitive Biomarker [2]
Amyloidosis DISHTAI2 Strong Altered Expression [3]
Anal cancer DISQUZFO Strong Biomarker [4]
Anus cancer DISW6NMZ Strong Biomarker [4]
Beta thalassemia DIS5RCQK Strong Biomarker [5]
Breast carcinoma DIS2UE88 Strong Biomarker [6]
Cholangiocarcinoma DIS71F6X Strong Biomarker [7]
Craniosynostosis DIS6J405 Strong Altered Expression [8]
Esophageal squamous cell carcinoma DIS5N2GV Strong Altered Expression [9]
Essential hypertension DIS7WI98 Strong Genetic Variation [10]
Factor IX deficiency DISHN9SC Strong Biomarker [11]
Familial Alzheimer disease DISE75U4 Strong Genetic Variation [12]
Haemophilia A DIS0RQ2E Strong Genetic Variation [11]
Hepatitis C virus infection DISQ0M8R Strong Biomarker [13]
Hereditary nonpolyposis colon cancer DISPA49R Strong Genetic Variation [14]
Hereditary spherocytosis DISQYJP5 Strong Genetic Variation [15]
Herpes simplex infection DISL1SAV Strong Biomarker [16]
High blood pressure DISY2OHH Strong Genetic Variation [10]
Inherited bleeding disorder, platelet-type DISIUNXT Strong Genetic Variation [11]
Metastatic malignant neoplasm DIS86UK6 Strong Biomarker [17]
Myocardial infarction DIS655KI Strong Biomarker [18]
Neoplasm DISZKGEW Strong Altered Expression [19]
Non-alcoholic fatty liver disease DISDG1NL Strong Biomarker [20]
Non-insulin dependent diabetes DISK1O5Z Strong Altered Expression [21]
Von Willebrand disease 2 DISEYUBR Strong Genetic Variation [22]
Chronic otitis media DIS3P3TG moderate Altered Expression [23]
Head-neck squamous cell carcinoma DISF7P24 moderate Biomarker [19]
Methicillin-resistant staphylococci infection DIS6DRDZ moderate Genetic Variation [24]
Type-1/2 diabetes DISIUHAP moderate Biomarker [25]
Bladder cancer DISUHNM0 Limited Biomarker [26]
Breast cancer DIS7DPX1 Limited Biomarker [6]
Gastric cancer DISXGOUK Limited Biomarker [27]
Gastric neoplasm DISOKN4Y Limited Biomarker [27]
Glaucoma/ocular hypertension DISLBXBY Limited Genetic Variation [28]
Hereditary diffuse gastric adenocarcinoma DISUIBYS Limited Biomarker [27]
Keratoconjunctivitis sicca DISNOENH Limited Altered Expression [29]
Ocular hypertension DISC2BT9 Limited Genetic Variation [28]
Sickle-cell anaemia DIS5YNZB Limited Genetic Variation [30]
Sjogren syndrome DISUBX7H Limited Altered Expression [29]
Type-1 diabetes DIS7HLUB Limited Biomarker [31]
Urinary bladder cancer DISDV4T7 Limited Biomarker [26]
Urinary bladder neoplasm DIS7HACE Limited Biomarker [26]
------------------------------------------------------------------------------------
⏷ Show the Full List of 43 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Decitabine DMQL8XJ Approved Decitabine increases the expression of Small proline-rich protein 2A (SPRR2A). [27]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Small proline-rich protein 2A (SPRR2A). [33]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Small proline-rich protein 2A (SPRR2A). [35]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Small proline-rich protein 2A (SPRR2A). [34]
------------------------------------------------------------------------------------

References

1 A Shared Epitope of Collagen Type XI and Type II Is Recognized by Pathogenic Antibodies in Mice and Humans with Arthritis.Front Immunol. 2018 Apr 12;9:451. doi: 10.3389/fimmu.2018.00451. eCollection 2018.
2 Structural and Functional Associations of Macular Microcirculation in the Ganglion Cell-Inner Plexiform Layer in Glaucoma Using Optical Coherence Tomography Angiography.J Glaucoma. 2018 Mar;27(3):281-290. doi: 10.1097/IJG.0000000000000888.
3 Orientin Improves Cognition by Enhancing Autophagosome Clearance in an Alzheimer's Mouse Model.J Mol Neurosci. 2019 Oct;69(2):246-253. doi: 10.1007/s12031-019-01353-5. Epub 2019 Jun 26.
4 Expression analysis and mutational screening of the epithelium-specific ets gene-1 (ESE-1) in patients with squamous anal cancer.Int J Oncol. 2000 Aug;17(2):265-70. doi: 10.3892/ijo.17.2.265.
5 High-resolution melting analysis for noninvasive prenatal diagnosis of IVS-II-I (G-A) fetal DNA in minor beta-thalassemia mothers.J Matern Fetal Neonatal Med. 2016 Oct;29(20):3323-8. doi: 10.3109/14767058.2015.1124263. Epub 2015 Dec 23.
6 Autophagy mediates free fatty acid effects on MDA-MB-231 cell proliferation, migration and invasion.Oncol Lett. 2017 Oct;14(4):4715-4721. doi: 10.3892/ol.2017.6807. Epub 2017 Aug 24.
7 Breast tumor kinase/protein tyrosine kinase 6 (Brk/PTK6) activity in normal and neoplastic biliary epithelia.J Hepatol. 2015 Aug;63(2):399-407. doi: 10.1016/j.jhep.2015.02.047. Epub 2015 Mar 12.
8 RNA sequencing and pathway analysis identify tumor necrosis factor alpha driven small proline-rich protein dysregulation in chronic rhinosinusitis.Am J Rhinol Allergy. 2017 Sep 1;31(5):283-288. doi: 10.2500/ajra.2017.31.4457.
9 Discovery of Ca2+-relevant and differentiation-associated genes downregulated in esophageal squamous cell carcinoma using cDNA microarray.Oncogene. 2004 Feb 12;23(6):1291-9. doi: 10.1038/sj.onc.1207218.
10 Association of two well-defined polymorphisms in leptin and leptin receptor genes with hypertension and circulating leptin: a meta-analysis.Arch Med Res. 2015 Jan;46(1):38-46. doi: 10.1016/j.arcmed.2014.11.012. Epub 2014 Dec 2.
11 Inherited bleeding disorders in older women.Maturitas. 2012 May;72(1):35-41. doi: 10.1016/j.maturitas.2012.02.008. Epub 2012 Mar 22.
12 Lysosomal alkalization and dysfunction in human fibroblasts with the Alzheimer's disease-linked presenilin 1 A246E mutation can be reversed with cAMP.Neuroscience. 2014 Mar 28;263:111-24. doi: 10.1016/j.neuroscience.2014.01.001. Epub 2014 Jan 10.
13 Hepatitis GBV-C sequences in patients infected with HCV contaminated anti-D immunoglobulin and among i.v. drug users in Germany.J Hepatol. 1996 Sep;25(3):385-9. doi: 10.1016/s0168-8278(96)80126-7.
14 Hereditary nonpolyposis colorectal cancer (Lynch syndromes I and II). I. Clinical description of resource.Cancer. 1985 Aug 15;56(4):934-8. doi: 10.1002/1097-0142(19850815)56:4<934::aid-cncr2820560439>3.0.co;2-i.
15 Hereditary spherocytosis associated with mutations in HFE gene.Ann Hematol. 2003 Dec;82(12):769-72. doi: 10.1007/s00277-003-0733-y. Epub 2003 Sep 5.
16 Herpes simplex virus type 1 infection leads to loss of serine-2 phosphorylation on the carboxyl-terminal domain of RNA polymerase II.J Virol. 2005 Sep;79(17):11323-34. doi: 10.1128/JVI.79.17.11323-11334.2005.
17 Small proline rich protein 2a in benign and malignant liver disease.Hepatology. 2014 Mar;59(3):1130-43. doi: 10.1002/hep.26889. Epub 2014 Jan 27.
18 Progressive Reduction in Myocyte Autophagy After Myocardial Infarction in Rabbits: Association with Oxidative Stress and Left Ventricular Remodeling.Cell Physiol Biochem. 2017;44(6):2439-2454. doi: 10.1159/000486167. Epub 2017 Dec 18.
19 Comprehensive Genomic Profiling of Patient-matched Head and Neck Cancer Cells: A Preclinical Pipeline for Metastatic and Recurrent Disease.Mol Cancer Res. 2018 Dec;16(12):1912-1926. doi: 10.1158/1541-7786.MCR-18-0056. Epub 2018 Aug 14.
20 Increased Serum Angiotensin II Is a Risk Factor of Nonalcoholic Fatty Liver Disease: A Prospective Pilot Study.Gastroenterol Res Pract. 2019 Nov 13;2019:5647161. doi: 10.1155/2019/5647161. eCollection 2019.
21 The Mitochondrial Antioxidant SS-31 Modulates Oxidative Stress, Endoplasmic Reticulum Stress, and Autophagy in Type 2 Diabetes.J Clin Med. 2019 Aug 28;8(9):1322. doi: 10.3390/jcm8091322.
22 A new variant of von Willebrand disease (type II I) with a normal degree of proteolytic cleavage of von Willebrand factor.Thromb Res. 1992 Feb 1;65(3):343-51. doi: 10.1016/0049-3848(92)90165-7.
23 Role of Autophagy in Acquired Cholesteatoma.Otol Neurotol. 2019 Dec;40(10):e993-e998. doi: 10.1097/MAO.0000000000002404.
24 Vancomycin tolerant, methicillin-resistant Staphylococcus aureus reveals the effects of vancomycin on cell wall thickening.PLoS One. 2015 Mar 20;10(3):e0118791. doi: 10.1371/journal.pone.0118791. eCollection 2015.
25 Prevention of type 1 diabetes by gene therapy.J Clin Invest. 2004 Oct;114(7):969-78. doi: 10.1172/JCI22103.
26 Inhibition of autophagy enhances the anticancer effect of enzalutamide on bladder cancer.Biomed Pharmacother. 2019 Dec;120:109490. doi: 10.1016/j.biopha.2019.109490. Epub 2019 Sep 28.
27 Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
28 Incidence and risk factors for post-penetrating keratoplasty glaucoma: A systematic review and meta-analysis.PLoS One. 2017 Apr 21;12(4):e0176261. doi: 10.1371/journal.pone.0176261. eCollection 2017.
29 Elevation of autophagy markers in Sjgren syndrome dry eye.Sci Rep. 2017 Dec 8;7(1):17280. doi: 10.1038/s41598-017-17128-0.
30 Cell-free fetal DNA in amniotic fluid supernatant for prenatal diagnosis.Cell Mol Biol (Noisy-le-grand). 2016 Apr 30;62(4):14-7.
31 A structural framework for deciphering the link between I-Ag7 and autoimmune diabetes.Science. 2000 Apr 21;288(5465):505-11. doi: 10.1126/science.288.5465.505.
32 Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
33 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
34 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
35 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.