Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6T2DDL)

DOT Name Programmed cell death protein 5 (PDCD5)
Synonyms TF-1 cell apoptosis-related protein 19; Protein TFAR19
Gene Name PDCD5
Related Disease
Advanced cancer ( )
Gastric neoplasm ( )
Acute erythroid leukemia ( )
Allergic asthma ( )
Autoimmune disease ( )
B-cell neoplasm ( )
Bone giant cell tumor ( )
Hepatitis B virus infection ( )
Hepatocellular carcinoma ( )
Leukemia ( )
Lung adenocarcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Malignant glioma ( )
Medullary thyroid gland carcinoma ( )
Melorheostosis ( )
Neoplasm ( )
Osteoarthritis ( )
Plasma cell myeloma ( )
Rheumatoid arthritis ( )
Skin cancer ( )
Bone osteosarcoma ( )
Breast cancer ( )
Breast carcinoma ( )
Chondrosarcoma ( )
Colorectal carcinoma ( )
Gastric cancer ( )
Laryngeal squamous cell carcinoma ( )
Osteosarcoma ( )
Serous cystadenocarcinoma ( )
Stomach cancer ( )
Metastatic malignant neoplasm ( )
Arteriosclerosis ( )
Arthritis ( )
Atherosclerosis ( )
leukaemia ( )
Prostate cancer ( )
Prostate carcinoma ( )
Type-1/2 diabetes ( )
UniProt ID
PDCD5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1YYB; 2CRU; 2K6B
Pfam ID
PF01984
Sequence
MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLA
LVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSD
EDDDY
Function May function in the process of apoptosis.
Tissue Specificity Widely expressed. Highest levels in heart, testis, kidney, pituitary gland, adrenal gland and placenta.

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Definitive Altered Expression [1]
Gastric neoplasm DISOKN4Y Definitive Biomarker [2]
Acute erythroid leukemia DISZFC1O Strong Biomarker [3]
Allergic asthma DISHF0H3 Strong Biomarker [4]
Autoimmune disease DISORMTM Strong Altered Expression [5]
B-cell neoplasm DISVY326 Strong Altered Expression [6]
Bone giant cell tumor DIS0RGK9 Strong Altered Expression [7]
Hepatitis B virus infection DISLQ2XY Strong Altered Expression [8]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [9]
Leukemia DISNAKFL Strong Biomarker [10]
Lung adenocarcinoma DISD51WR Strong Altered Expression [11]
Lung cancer DISCM4YA Strong Biomarker [11]
Lung carcinoma DISTR26C Strong Biomarker [11]
Malignant glioma DISFXKOV Strong Biomarker [12]
Medullary thyroid gland carcinoma DISHBL3K Strong Altered Expression [13]
Melorheostosis DISIMCL3 Strong Biomarker [3]
Neoplasm DISZKGEW Strong Biomarker [14]
Osteoarthritis DIS05URM Strong Biomarker [15]
Plasma cell myeloma DIS0DFZ0 Strong Altered Expression [16]
Rheumatoid arthritis DISTSB4J Strong Altered Expression [17]
Skin cancer DISTM18U Strong Biomarker [18]
Bone osteosarcoma DIST1004 moderate Altered Expression [19]
Breast cancer DIS7DPX1 moderate Biomarker [20]
Breast carcinoma DIS2UE88 moderate Biomarker [20]
Chondrosarcoma DIS4I7JB moderate Altered Expression [21]
Colorectal carcinoma DIS5PYL0 moderate Biomarker [22]
Gastric cancer DISXGOUK moderate Biomarker [23]
Laryngeal squamous cell carcinoma DIS9UUVF moderate Altered Expression [24]
Osteosarcoma DISLQ7E2 moderate Altered Expression [19]
Serous cystadenocarcinoma DISVK716 moderate Altered Expression [25]
Stomach cancer DISKIJSX moderate Biomarker [23]
Metastatic malignant neoplasm DIS86UK6 Disputed Biomarker [19]
Arteriosclerosis DISK5QGC Limited Biomarker [26]
Arthritis DIST1YEL Limited Biomarker [27]
Atherosclerosis DISMN9J3 Limited Biomarker [26]
leukaemia DISS7D1V Limited Biomarker [10]
Prostate cancer DISF190Y Limited Biomarker [28]
Prostate carcinoma DISMJPLE Limited Biomarker [28]
Type-1/2 diabetes DISIUHAP Limited Altered Expression [26]
------------------------------------------------------------------------------------
⏷ Show the Full List of 39 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Programmed cell death protein 5 (PDCD5) increases the response to substance of Cisplatin. [22]
Dexamethasone DMMWZET Approved Programmed cell death protein 5 (PDCD5) increases the response to substance of Dexamethasone. [41]
------------------------------------------------------------------------------------
13 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Programmed cell death protein 5 (PDCD5). [29]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Programmed cell death protein 5 (PDCD5). [30]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Programmed cell death protein 5 (PDCD5). [31]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Programmed cell death protein 5 (PDCD5). [32]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Programmed cell death protein 5 (PDCD5). [30]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Programmed cell death protein 5 (PDCD5). [33]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Programmed cell death protein 5 (PDCD5). [34]
Demecolcine DMCZQGK Approved Demecolcine decreases the expression of Programmed cell death protein 5 (PDCD5). [35]
Menthol DMG2KW7 Approved Menthol decreases the expression of Programmed cell death protein 5 (PDCD5). [36]
Acetic Acid, Glacial DM4SJ5Y Approved Acetic Acid, Glacial decreases the expression of Programmed cell death protein 5 (PDCD5). [37]
Motexafin gadolinium DMEJKRF Approved Motexafin gadolinium decreases the expression of Programmed cell death protein 5 (PDCD5). [37]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate decreases the expression of Programmed cell death protein 5 (PDCD5). [38]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Programmed cell death protein 5 (PDCD5). [39]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Drug(s)

References

1 Low programmed cell death 5 expression is a prognostic factor in ovarian cancer.Chin Med J (Engl). 2015 Apr 20;128(8):1084-90. doi: 10.4103/0366-6999.155100.
2 Expression of programmed cell death 5 gene involves in regulation of apoptosis in gastric tumor cells.Apoptosis. 2006 Jun;11(6):993-1001. doi: 10.1007/s10495-006-6714-6.
3 TFAR19 gene changes the biophysical properties of murine erythroleukemia cells.Cell Biochem Biophys. 2005;43(3):355-63. doi: 10.1385/CBB:43:3:355.
4 Effect of Tiotropium Bromide on Airway Inflammation and Programmed Cell Death 5 in a Mouse Model of Ovalbumin-Induced Allergic Asthma.Can Respir J. 2019 Oct 1;2019:6462171. doi: 10.1155/2019/6462171. eCollection 2019.
5 PDCD5 negatively regulates autoimmunity by upregulating FOXP3(+) regulatory T cells and suppressing Th17 and Th1 responses.J Autoimmun. 2013 Dec;47:34-44. doi: 10.1016/j.jaut.2013.08.002. Epub 2013 Sep 5.
6 The Molecular Evolution and Functional Divergence of Lamprey Programmed Cell Death Genes.Front Immunol. 2019 Jun 20;10:1382. doi: 10.3389/fimmu.2019.01382. eCollection 2019.
7 Clinicopathological Significance of Decreased Expression of the Tumor Inhibitor Gene PDCD5 in Osteoclastoma.Genet Test Mol Biomarkers. 2019 Nov;23(11):807-814. doi: 10.1089/gtmb.2019.0082. Epub 2019 Oct 22.
8 PDCD5 expression predicts a favorable outcome in patients with hepatocellular carcinoma.Int J Oncol. 2013 Sep;43(3):821-30. doi: 10.3892/ijo.2013.1993. Epub 2013 Jun 26.
9 Lgr5-mediated p53 Repression through PDCD5 leads to doxorubicin resistance in Hepatocellular Carcinoma.Theranostics. 2019 May 9;9(10):2967-2983. doi: 10.7150/thno.30562. eCollection 2019.
10 Synergistic antitumoral efficacy of a novel replicative adenovirus SG611-PDCD5 and daunorubicin in human leukemic cells.Onco Targets Ther. 2018 Aug 23;11:5121-5132. doi: 10.2147/OTT.S167868. eCollection 2018.
11 Expression of programmed cell death 5 protein inhibits progression of lung carcinoma in vitro and in vivo via the mitochondrial apoptotic pathway.Mol Med Rep. 2014 Oct;10(4):2059-64. doi: 10.3892/mmr.2014.2454. Epub 2014 Aug 5.
12 PDCD5 promotes cisplatin-induced apoptosis of glioma cells via activating mitochondrial apoptotic pathway.Cancer Biol Ther. 2012 Jul;13(9):822-30. doi: 10.4161/cbt.20565. Epub 2012 Jun 12.
13 Christia vespertilionis plant extracts as novel antiproliferative agent against human neuroendocrine tumor cells.Oncol Rep. 2013 Jun;29(6):2219-26. doi: 10.3892/or.2013.2367. Epub 2013 Mar 26.
14 PDCD5 regulates cell proliferation, cell cycle progression and apoptosis.Oncol Lett. 2018 Jan;15(1):1177-1183. doi: 10.3892/ol.2017.7401. Epub 2017 Nov 14.
15 Effects of Tumor Necrosis Factor Alpha on the Expression of Programmed Cell Death Factor 5 in Arthritis.Orthop Surg. 2019 Aug;11(4):698-704. doi: 10.1111/os.12497. Epub 2019 Jul 8.
16 Establishment of stable multiple myeloma cell line with overexpressed PDCD5 and its proapoptosis mechanism.Int J Clin Exp Pathol. 2015 Sep 1;8(9):10635-43. eCollection 2015.
17 Plasma and synovial fluid programmed cell death 5 (PDCD5) levels are inversely associated with TNF- and disease activity in patients with rheumatoid arthritis.Biomarkers. 2013 Mar;18(2):155-9. doi: 10.3109/1354750X.2012.759277. Epub 2013 Jan 18.
18 Transgenic human programmed cell death 5 expression in mice suppresses skin cancer development by enhancing apoptosis.Life Sci. 2013 Jul 10;92(24-26):1208-14. doi: 10.1016/j.lfs.2013.05.005. Epub 2013 May 18.
19 PDCD5 inhibits osteosarcoma cell metastasis via targeting TGF-1/Smad signaling pathway and is associated with good prognosis.Am J Transl Res. 2019 Feb 15;11(2):1116-1128. eCollection 2019.
20 Recombinant human PDCD5 protein enhances chemosensitivity of breast cancer in vitro and in vivo.Biochem Cell Biol. 2013 Dec;91(6):526-31. doi: 10.1139/bcb-2013-0052. Epub 2013 Sep 13.
21 Diagnostic investigations of DKK-1 and PDCD5 expression levels as independent prognostic markers of human chondrosarcoma.IUBMB Life. 2016 Jul;68(7):597-601. doi: 10.1002/iub.1519. Epub 2016 Jun 3.
22 Transfection of PDCD5 sensitizes colorectal cancer cells to cisplatin-induced apoptosis in vitro and in vivo. Eur J Pharmacol. 2010 Dec 15;649(1-3):120-6. doi: 10.1016/j.ejphar.2010.09.040. Epub 2010 Sep 24.
23 Downregulated PITX1 Modulated by MiR-19a-3p Promotes Cell Malignancy and Predicts a Poor Prognosis of Gastric Cancer by Affecting Transcriptionally Activated PDCD5.Cell Physiol Biochem. 2018;46(6):2215-2231. doi: 10.1159/000489590. Epub 2018 May 3.
24 Expression and clinical significance of the programmed cell death 5 gene and protein in laryngeal squamous cell carcinoma.J Int Med Res. 2013 Dec;41(6):1838-47. doi: 10.1177/0300060513498021.
25 Clinical and prognostic significance of lost or decreased PDCD5 expression in human epithelial ovarian carcinomas.Oncol Rep. 2011 Feb;25(2):353-8. doi: 10.3892/or.2010.1103. Epub 2010 Dec 13.
26 Programmed cell death 5 suppresses AKT-mediated cytoprotection of endothelium.Proc Natl Acad Sci U S A. 2018 May 1;115(18):4672-4677. doi: 10.1073/pnas.1712918115. Epub 2018 Mar 27.
27 Programmed cell death 5 transgenic mice attenuates adjuvant induced arthritis by 2 modifying the T lymphocytes balance.Biol Res. 2017 Dec 11;50(1):40. doi: 10.1186/s40659-017-0145-4.
28 Cisplatin in combination with programmed cell death protein5 increases antitumor activity in prostate cancer cells by promoting apoptosis.Mol Med Rep. 2015 Jun;11(6):4561-6. doi: 10.3892/mmr.2015.3252. Epub 2015 Jan 26.
29 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
30 Comparison of the gene expression profiles of monocytic versus granulocytic lineages of HL-60 leukemia cell differentiation by DNA microarray analysis. Life Sci. 2003 Aug 15;73(13):1705-19. doi: 10.1016/s0024-3205(03)00515-0.
31 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
32 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
33 Proteomic analysis revealed association of aberrant ROS signaling with suberoylanilide hydroxamic acid-induced autophagy in Jurkat T-leukemia cells. Autophagy. 2010 Aug;6(6):711-24. doi: 10.4161/auto.6.6.12397. Epub 2010 Aug 17.
34 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
35 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
36 Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
37 Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
38 Epigallocatechin-3-gallate (EGCG) protects against chromate-induced toxicity in vitro. Toxicol Appl Pharmacol. 2012 Jan 15;258(2):166-75.
39 Expression and DNA methylation changes in human breast epithelial cells after bisphenol A exposure. Int J Oncol. 2012 Jul;41(1):369-77.
40 Transfection of PDCD5 sensitizes colorectal cancer cells to cisplatin-induced apoptosis in vitro and in vivo. Eur J Pharmacol. 2010 Dec 15;649(1-3):120-6. doi: 10.1016/j.ejphar.2010.09.040. Epub 2010 Sep 24.
41 [Effect of human recombinant PDCD5 protein on cell apoptosis of multiple myeloma KM3 cells induced by dexamethasone and its mechanism]. Zhong Nan Da Xue Xue Bao Yi Xue Ban. 2010 Jul;35(7):725-31. doi: 10.3969/j.issn.1672-7347.2010.07.013.