Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT83ZNPP)

DOT Name CD48 antigen (CD48)
Synonyms B-lymphocyte activation marker BLAST-1; BCM1 surface antigen; Leukocyte antigen MEM-102; SLAM family member 2; SLAMF2; Signaling lymphocytic activation molecule 2; TCT.1; CD antigen CD48
Gene Name CD48
Related Disease
Acute lymphocytic leukaemia ( )
Acute myelogenous leukaemia ( )
Adult lymphoma ( )
Advanced cancer ( )
Atopic dermatitis ( )
Autoimmune lymphoproliferative syndrome type 1 ( )
Bacillary dysentery ( )
Beckwith-Wiedemann syndrome ( )
Brain neoplasm ( )
Castleman's disease ( )
Childhood acute lymphoblastic leukemia ( )
Coeliac disease ( )
Endometriosis ( )
Fanconi anemia complementation group A ( )
Fanconi's anemia ( )
Glioma ( )
Glomerulonephritis ( )
Influenza ( )
Leukemia ( )
Lupus ( )
Lyme disease ( )
Lymphoma ( )
Multiple sclerosis ( )
Myelodysplastic syndrome ( )
Nervous system inflammation ( )
Obesity ( )
Pancytopenia ( )
Paroxysmal nocturnal haemoglobinuria ( )
Pediatric lymphoma ( )
Prostate cancer ( )
Prostate carcinoma ( )
Rheumatoid arthritis ( )
Systemic lupus erythematosus ( )
Tetralogy of fallot ( )
Tuberculosis ( )
Zika virus infection ( )
Asthma ( )
Epstein barr virus infection ( )
Plasma cell myeloma ( )
Aplastic anemia ( )
Enterovirus infection ( )
Intrinsic asthma ( )
leukaemia ( )
Neoplasm ( )
Non-insulin dependent diabetes ( )
UniProt ID
CD48_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2EDO
Pfam ID
PF13895 ; PF07686
Sequence
MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFY
TFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQE
WKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSV
LETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGL
LLT
Function
Glycosylphosphatidylinositol (GPI)-anchored cell surface glycoprotein that interacts via its N-terminal immunoglobulin domain with cell surface receptors including 2B4/CD244 or CD2 to regulate immune cell function and activation. Participates in T-cell signaling transduction by associating with CD2 and efficiently bringing the Src family protein kinase LCK and LAT to the TCR/CD3 complex. In turn, promotes LCK phosphorylation and subsequent activation. Induces the phosphorylation of the cytoplasmic immunoreceptortyrosine switch motifs (ITSMs) of CD244 initiating a series of signaling events that leads to the generation of the immunological synapse and the directed release of cytolytic granules containing perforin and granzymes by T-lymphocytes and NK-cells.
Tissue Specificity Widely expressed on all hematopoietic cells.
KEGG Pathway
.tural killer cell mediated cytotoxicity (hsa04650 )
Reactome Pathway
Cell surface interactions at the vascular wall (R-HSA-202733 )

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute lymphocytic leukaemia DISPX75S Strong Altered Expression [1]
Acute myelogenous leukaemia DISCSPTN Strong Biomarker [2]
Adult lymphoma DISK8IZR Strong Biomarker [3]
Advanced cancer DISAT1Z9 Strong Biomarker [4]
Atopic dermatitis DISTCP41 Strong Biomarker [5]
Autoimmune lymphoproliferative syndrome type 1 DISAFGRA Strong Altered Expression [6]
Bacillary dysentery DISFZHKN Strong Biomarker [7]
Beckwith-Wiedemann syndrome DISH15GR Strong Genetic Variation [8]
Brain neoplasm DISY3EKS Strong Genetic Variation [9]
Castleman's disease DISVC11M Strong Biomarker [10]
Childhood acute lymphoblastic leukemia DISJ5D6U Strong Altered Expression [1]
Coeliac disease DISIY60C Strong Genetic Variation [11]
Endometriosis DISX1AG8 Strong Biomarker [7]
Fanconi anemia complementation group A DIS8PZLI Strong Biomarker [12]
Fanconi's anemia DISGW6Q8 Strong Biomarker [12]
Glioma DIS5RPEH Strong Biomarker [13]
Glomerulonephritis DISPZIQ3 Strong Biomarker [14]
Influenza DIS3PNU3 Strong Biomarker [15]
Leukemia DISNAKFL Strong Biomarker [16]
Lupus DISOKJWA Strong Genetic Variation [14]
Lyme disease DISO70G5 Strong Biomarker [17]
Lymphoma DISN6V4S Strong Biomarker [3]
Multiple sclerosis DISB2WZI Strong Altered Expression [18]
Myelodysplastic syndrome DISYHNUI Strong Genetic Variation [19]
Nervous system inflammation DISB3X5A Strong Biomarker [18]
Obesity DIS47Y1K Strong Biomarker [20]
Pancytopenia DISVKEHV Strong Biomarker [21]
Paroxysmal nocturnal haemoglobinuria DISBHMYH Strong Genetic Variation [19]
Pediatric lymphoma DIS51BK2 Strong Biomarker [3]
Prostate cancer DISF190Y Strong Biomarker [22]
Prostate carcinoma DISMJPLE Strong Biomarker [22]
Rheumatoid arthritis DISTSB4J Strong Genetic Variation [23]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [24]
Tetralogy of fallot DISMHFNW Strong Genetic Variation [25]
Tuberculosis DIS2YIMD Strong Biomarker [26]
Zika virus infection DISQUCTY Strong Biomarker [27]
Asthma DISW9QNS moderate Biomarker [28]
Epstein barr virus infection DISOO0WT moderate Altered Expression [29]
Plasma cell myeloma DIS0DFZ0 moderate Biomarker [30]
Aplastic anemia DISJRSC0 Limited Biomarker [19]
Enterovirus infection DISH2UDP Limited Biomarker [31]
Intrinsic asthma DIS2U1Q9 Limited Biomarker [28]
leukaemia DISS7D1V Limited Biomarker [16]
Neoplasm DISZKGEW Limited Biomarker [32]
Non-insulin dependent diabetes DISK1O5Z Limited Biomarker [33]
------------------------------------------------------------------------------------
⏷ Show the Full List of 45 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of CD48 antigen (CD48). [34]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of CD48 antigen (CD48). [35]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of CD48 antigen (CD48). [36]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of CD48 antigen (CD48). [37]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of CD48 antigen (CD48). [38]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of CD48 antigen (CD48). [39]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of CD48 antigen (CD48). [41]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of CD48 antigen (CD48). [42]
Manganese DMKT129 Investigative Manganese increases the expression of CD48 antigen (CD48). [43]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of CD48 antigen (CD48). [40]
------------------------------------------------------------------------------------

References

1 Biphenotypic acute leukemia with coexpression of CD79a and markers of myeloid lineage.Arch Pathol Lab Med. 2003 Mar;127(3):356-9. doi: 10.5858/2003-127-0356-BALWCO.
2 Secreted 3-integrin enhances natural killer cell activity against acute myeloid leukemia cells.PLoS One. 2014 Jun 11;9(2):e98936. doi: 10.1371/journal.pone.0098936. eCollection 2014.
3 Signalling pathways identified in salivary glands from primary Sjgren's syndrome patients reveal enhanced adipose tissue development.Autoimmunity. 2018 May;51(3):135-146. doi: 10.1080/08916934.2018.1446525. Epub 2018 Mar 5.
4 A high throughput method for identifying personalized tumor-associated antigens.Oncotarget. 2010 Jun;1(2):148-55. doi: 10.18632/oncotarget.118.
5 The CD48 receptor mediates Staphylococcus aureus human and murine eosinophil activation.Clin Exp Allergy. 2014 Nov;44(11):1335-46. doi: 10.1111/cea.12422.
6 The induction of Bim expression in human T-cell blasts is dependent on nonapoptotic Fas/CD95 signaling.Blood. 2007 Feb 15;109(4):1627-35. doi: 10.1182/blood-2006-05-022319. Epub 2006 Oct 24.
7 Role of Shigella infection in endometriosis: a novel hypothesis.Med Hypotheses. 2008;70(2):239-43. doi: 10.1016/j.mehy.2007.06.012. Epub 2007 Sep 20.
8 C11orf21, a novel gene within the Beckwith-Wiedemann syndrome region in human chromosome 11p15.5.Gene. 2000 Oct 3;256(1-2):311-7. doi: 10.1016/s0378-1119(00)00377-2.
9 An evaluation of language in brain tumor patients using a new cognitively motivated testing protocol.Neuropsychology. 2017 Sep;31(6):648-665. doi: 10.1037/neu0000374. Epub 2017 Apr 6.
10 Clinical, laboratory and imaging findings in Castleman's disease - The subtype decides.Blood Rev. 2018 May;32(3):225-234. doi: 10.1016/j.blre.2017.11.005. Epub 2017 Nov 29.
11 Gluten ataxia is better classified as non-celiac gluten sensitivity than as celiac disease: a comparative clinical study.Immunol Res. 2016 Apr;64(2):558-64. doi: 10.1007/s12026-015-8750-1.
12 Evolutionary clues to the molecular function of fanconi anemia genes.Acta Haematol. 2002;108(4):231-6. doi: 10.1159/000065659.
13 CD48 is a key molecule of immunomodulation affecting prognosis in glioma.Onco Targets Ther. 2019 May 28;12:4181-4193. doi: 10.2147/OTT.S198762. eCollection 2019.
14 Auto-antibody production and glomerulonephritis in congenic Slamf1-/- and Slamf2-/- [B6.129] but not in Slamf1-/- and Slamf2-/- [BALB/c.129] mice.Int Immunol. 2011 Feb;23(2):149-58. doi: 10.1093/intimm/dxq465. Epub 2011 Jan 28.
15 MapMyFlu: visualizing spatio-temporal relationships between related influenza sequences.Nucleic Acids Res. 2015 Jul 1;43(W1):W547-51. doi: 10.1093/nar/gkv417. Epub 2015 May 4.
16 TGF- regulated leukemia cell susceptibility against NK targeting through the down-regulation of the CD48 expression.Immunobiology. 2019 Sep;224(5):649-658. doi: 10.1016/j.imbio.2019.07.002. Epub 2019 Aug 9.
17 Lsa63, a newly identified surface protein of Leptospira interrogans binds laminin and collagen IV.J Infect. 2010 Jan;60(1):52-64. doi: 10.1016/j.jinf.2009.10.047. Epub 2009 Oct 30.
18 Anti-CD48 Monoclonal Antibody Attenuates Experimental Autoimmune Encephalomyelitis by Limiting the Number of Pathogenic CD4+ T Cells.J Immunol. 2016 Oct 15;197(8):3038-3048. doi: 10.4049/jimmunol.1600706. Epub 2016 Aug 31.
19 High frequency of several PIG-A mutations in patients with aplastic anemia and myelodysplastic syndrome.Leukemia. 2006 Apr;20(4):627-34. doi: 10.1038/sj.leu.2404135.
20 Comparative genome analysis with the human genome reveals chicken genes associated with fatness and body weight.Anim Genet. 2011 Dec;42(6):642-9. doi: 10.1111/j.1365-2052.2011.02191.x. Epub 2011 Apr 13.
21 GPI-anchored protein-deficient T cells in patients with aplastic anemia and low-risk myelodysplastic syndrome: implications for the immunopathophysiology of bone marrow failure.Eur J Haematol. 2011 Mar;86(3):226-36. doi: 10.1111/j.1600-0609.2010.01563.x. Epub 2011 Jan 21.
22 A candidate prostate cancer susceptibility gene encodes tRNA 3' processing endoribonuclease.Nucleic Acids Res. 2003 May 1;31(9):2272-8. doi: 10.1093/nar/gkg337.
23 Restriction fragment length polymorphism of a lymphocyte surface antigen, Blast-1, in Japanese and Caucasians, and in patients with rheumatoid arthritis.Tissue Antigens. 1990 May;35(5):203-5. doi: 10.1111/j.1399-0039.1990.tb01783.x.
24 Expression patterns of signaling lymphocytic activation molecule family members in peripheral blood mononuclear cell subsets in patients with systemic lupus erythematosus.PLoS One. 2017 Oct 11;12(10):e0186073. doi: 10.1371/journal.pone.0186073. eCollection 2017.
25 Mutational analysis of JAG1 gene in non-syndromic tetralogy of Fallot children. Clin Chim Acta. 2011 Nov 20;412(23-24):2232-6. doi: 10.1016/j.cca.2011.08.017. Epub 2011 Aug 27.
26 Rapid and simple approach for identification of Mycobacterium tuberculosis and M. bovis by detection of regulatory gene whiB7.Acta Microbiol Immunol Hung. 2011 Mar;58(1):65-74. doi: 10.1556/AMicr.58.2011.1.7.
27 Combination random isothermal amplification and nanopore sequencing for rapid identification of the causative agent of an outbreak.J Clin Virol. 2018 Sep;106:23-27. doi: 10.1016/j.jcv.2018.07.001. Epub 2018 Jul 6.
28 Evaluation of Soluble CD48 Levels in Patients with Allergic and Nonallergic Asthma in Relation to Markers of Type 2 and Non-Type 2 Immunity: An Observational Study.J Immunol Res. 2018 Sep 16;2018:4236263. doi: 10.1155/2018/4236263. eCollection 2018.
29 Characterization of the CD48 gene demonstrates a positive element that is specific to Epstein-Barr virus-immortalized B-cell lines and contains an essential NF-kappa B site.J Virol. 1995 Feb;69(2):871-81. doi: 10.1128/JVI.69.2.871-881.1995.
30 Expression analysis of two SLAM family receptors, SLAMF2 and SLAMF7, in patients with multiple myeloma.Int J Hematol. 2019 Jul;110(1):69-76. doi: 10.1007/s12185-019-02649-3. Epub 2019 May 21.
31 Screening and Identification of Linear B Cell Epitopes Within the Nonstructural Proteins of Enterovirus 71.Viral Immunol. 2019 Mar;32(2):84-88. doi: 10.1089/vim.2018.0125. Epub 2018 Dec 6.
32 Distinct genetic profiles of extracranial and intracranial acral melanoma metastases.J Cutan Pathol. 2016 Oct;43(10):884-91. doi: 10.1111/cup.12746. Epub 2016 Jun 29.
33 No association of polymorphisms in human endogenous retrovirus K18 and CD48 with schizophrenia.Psychiatr Genet. 2012 Jun;22(3):146-8. doi: 10.1097/YPG.0b013e328353953c.
34 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
35 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
36 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
37 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
38 The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
39 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
40 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
41 Targeting MYC dependence in cancer by inhibiting BET bromodomains. Proc Natl Acad Sci U S A. 2011 Oct 4;108(40):16669-74. doi: 10.1073/pnas.1108190108. Epub 2011 Sep 26.
42 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
43 Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.