Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9Z23K5)

• DOT Name: Elongation factor 1-alpha 2 (EEF1A2)
• Synonyms: EF-1-alpha-2; Eukaryotic elongation factor 1 A-2; eEF1A-2; Statin-S1
• Gene Name: EEF1A2
• Related Disease:
  Complex neurodevelopmental disorder
  Epithelial ovarian cancer
  Ovarian cancer
  Ovarian neoplasm
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Carcinoma
  Dementia
  Developmental and epileptic encephalopathy, 33
  Dystonia
  Epilepsy
  Hepatocellular carcinoma
  Hyperglycemia
  Intellectual disability
  Intrahepatic cholangiocarcinoma
  Late-onset Parkinson disease
  Lung cancer
  Lung carcinoma
  Mental disorder
  Nervous system disease
  Neurodegenerative disease
  Neurodevelopmental disorder
  Non-small-cell lung cancer
  Parkinsonian disorder
  Plasma cell myeloma
  Prostate cancer
  Prostate carcinoma
  Psychotic disorder
  Restless legs syndrome
  Stomach cancer
  Systemic lupus erythematosus
  Tourette syndrome
  Triple negative breast cancer
  Vesicoureteral reflux
  Adenocarcinoma
  Advanced cancer
  Lung adenocarcinoma
  Autosomal dominant non-syndromic intellectual disability
  Undetermined early-onset epileptic encephalopathy
  Dilated cardiomyopathy
  Anxiety
  Anxiety disorder
  Autism spectrum disorder
  Gastric cancer
  Gastric neoplasm
  Hereditary diffuse gastric adenocarcinoma
  Pancreatic cancer
  Pervasive developmental disorder
  Stroke
• UniProt ID: EF1A2_HUMAN
• PDB ID: 3C5J; 8B6Z
• Pfam ID: PF00009 ; PF03144 ; PF03143
• Sequence:
  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
  DKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
  GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKK
  IGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTR
  PTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALS
  EALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPV
  IDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPP
  LGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAGK
• Function: This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.
• Tissue Specificity: Brain, heart, and skeletal muscle.
• KEGG Pathway:
  Nucleocytoplasmic transport (hsa03013)
  Legionellosis (hsa05134)
  Leishmaniasis (hsa05140)
• Reactome Pathway: Eukaryotic Translation Elongation (R-HSA-156842)

Molecular Interaction Atlas (MIA) of This DOT

50 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Complex neurodevelopmental disorder	DISB9AFI	Definitive	Autosomal dominant	[1]
Epithelial ovarian cancer	DIS56MH2	Definitive	Biomarker	[2]
Ovarian cancer	DISZJHAP	Definitive	Biomarker	[2]
Ovarian neoplasm	DISEAFTY	Definitive	Biomarker	[2]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[3]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[3]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[4]
Carcinoma	DISH9F1N	Strong	Altered Expression	[5]
Dementia	DISXL1WY	Strong	Biomarker	[6]
Developmental and epileptic encephalopathy, 33	DIS4YBH9	Strong	Autosomal dominant	[7]
Dystonia	DISJLFGW	Strong	Biomarker	[8]
Epilepsy	DISBB28L	Strong	Genetic Variation	[9]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[10]
Hyperglycemia	DIS0BZB5	Strong	Altered Expression	[11]
Intellectual disability	DISMBNXP	Strong	Biomarker	[9]
Intrahepatic cholangiocarcinoma	DIS6GOC8	Strong	Altered Expression	[12]
Late-onset Parkinson disease	DIS9IOUI	Strong	Biomarker	[13]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[14]
Lung carcinoma	DISTR26C	Strong	Genetic Variation	[14]
Mental disorder	DIS3J5R8	Strong	Genetic Variation	[13]
Nervous system disease	DISJ7GGT	Strong	Genetic Variation	[15]
Neurodegenerative disease	DISM20FF	Strong	Biomarker	[16]
Neurodevelopmental disorder	DIS372XH	Strong	Biomarker	[9]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Posttranslational Modification	[17]
Parkinsonian disorder	DISHGY45	Strong	Biomarker	[18]
Plasma cell myeloma	DIS0DFZ0	Strong	Altered Expression	[19]
Prostate cancer	DISF190Y	Strong	Altered Expression	[20]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[20]
Psychotic disorder	DIS4UQOT	Strong	Biomarker	[21]
Restless legs syndrome	DISNWY00	Strong	Biomarker	[22]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[23]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[24]
Tourette syndrome	DISX9D54	Strong	Biomarker	[25]
Triple negative breast cancer	DISAMG6N	Strong	Altered Expression	[26]
Vesicoureteral reflux	DISUL6SA	Strong	CausalMutation	[27]
Adenocarcinoma	DIS3IHTY	moderate	Altered Expression	[28]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[29]
Lung adenocarcinoma	DISD51WR	moderate	Altered Expression	[28]
Autosomal dominant non-syndromic intellectual disability	DISD6L06	Supportive	Autosomal dominant	[15]
Undetermined early-onset epileptic encephalopathy	DISISEI2	Supportive	Autosomal dominant	[30]
Dilated cardiomyopathy	DISX608J	Disputed	Genetic Variation	[31]
Anxiety	DISIJDBA	Limited	Biomarker	[32]
Anxiety disorder	DISBI2BT	Limited	Biomarker	[32]
Autism spectrum disorder	DISXK8NV	Limited	Biomarker	[9]
Gastric cancer	DISXGOUK	Limited	Altered Expression	[23]
Gastric neoplasm	DISOKN4Y	Limited	Biomarker	[33]
Hereditary diffuse gastric adenocarcinoma	DISUIBYS	Limited	Biomarker	[33]
Pancreatic cancer	DISJC981	Limited	Altered Expression	[34]
Pervasive developmental disorder	DIS51975	Limited	Biomarker	[9]
Stroke	DISX6UHX	Limited	Biomarker	[35]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic trioxide	DM61TA4	Approved	Elongation factor 1-alpha 2 (EEF1A2) decreases the response to substance of Arsenic trioxide.	[61]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Elongation factor 1-alpha 2 (EEF1A2).	[36]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Elongation factor 1-alpha 2 (EEF1A2).	[53]

24 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[37]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[38]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Elongation factor 1-alpha 2 (EEF1A2).	[39]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[40]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[41]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[42]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[43]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[44]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[45]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[33]
Selenium	DM25CGV	Approved	Selenium increases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[47]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[48]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[49]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[50]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[51]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[47]
LY294002	DMY1AFS	Phase 1	LY294002 decreases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[51]
PF-3758309	DM36PKZ	Phase 1	PF-3758309 increases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[54]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[55]
Wortmannin	DM8EVK5	Terminated	Wortmannin increases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[56]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[57]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[58]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[59]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid increases the expression of Elongation factor 1-alpha 2 (EEF1A2).	[60]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
DNCB	DMDTVYC	Phase 2	DNCB affects the binding of Elongation factor 1-alpha 2 (EEF1A2).	[52]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] The eukaryotic translation elongation factor eEF1A2 induces neoplastic properties and mediates tumorigenic effects of ZNF217 in precursor cells of human ovarian carcinomas.Int J Cancer. 2008 Oct 15;123(8):1761-9. doi: 10.1002/ijc.23708.
• [3] Expression of the actin-binding proteins indicates that cofilin and fascin are related to breast tumour size.J Int Med Res. 2010 May-Jun;38(3):1042-8. doi: 10.1177/147323001003800331.
• [4] Expression of protein elongation factor eEF1A2 predicts favorable outcome in breast cancer.Breast Cancer Res Treat. 2007 Mar;102(1):31-41. doi: 10.1007/s10549-006-9315-8. Epub 2006 Aug 9.
• [5] Expression of eEF1A2 is associated with clear cell histology in ovarian carcinomas: overexpression of the gene is not dependent on modifications at the EEF1A2 locus.Br J Cancer. 2007 May 21;96(10):1613-20. doi: 10.1038/sj.bjc.6603748. Epub 2007 Apr 17.
• [6] Predictors of dementia-free survival after bilateral subthalamic deep brain stimulation for Parkinson's disease.Neurol India. 2019 Mar-Apr;67(2):459-466. doi: 10.4103/0028-3886.258056.
• [7] Diagnostic exome sequencing in persons with severe intellectual disability. N Engl J Med. 2012 Nov 15;367(20):1921-9. doi: 10.1056/NEJMoa1206524. Epub 2012 Oct 3.
• [8] Physiological effects of subthalamic nucleus deep brain stimulation surgery in cervical dystonia.J Neurol Neurosurg Psychiatry. 2018 Dec;89(12):1296-1300. doi: 10.1136/jnnp-2017-317098. Epub 2018 Jan 11.
• [9] Mild epileptic phenotype associates with de novo eef1a2 mutation: Case report and review.Brain Dev. 2020 Jan;42(1):77-82. doi: 10.1016/j.braindev.2019.08.001. Epub 2019 Aug 30.
• [10] Etiology-dependent molecular mechanisms in human hepatocarcinogenesis.Hepatology. 2008 Feb;47(2):511-20. doi: 10.1002/hep.22033.
• [11] eEF1A2 exacerbated insulin resistance in male skeletal muscle via PKC and ER stress.J Endocrinol. 2020 Jan 1;244(1):25-40. doi: 10.1530/JOE-19-0051.
• [12] Overexpression of PDZK1IP1, EEF1A2 and RPL41 genes in intrahepatic cholangiocarcinoma.Mol Med Rep. 2016 Jun;13(6):4786-90. doi: 10.3892/mmr.2016.5110. Epub 2016 Apr 12.
• [13] Theta-alpha oscillations characterize emotional subregion in the human ventral subthalamic nucleus.Mov Disord. 2020 Feb;35(2):337-343. doi: 10.1002/mds.27910. Epub 2019 Nov 23.
• [14] The expression profile and prognostic significance of eukaryotic translation elongation factors in different cancers.PLoS One. 2018 Jan 17;13(1):e0191377. doi: 10.1371/journal.pone.0191377. eCollection 2018.
• [15] De novo EEF1A2 mutations in patients with characteristic facial features, intellectual disability, autistic behaviors and epilepsy. Clin Genet. 2015 Apr;87(4):356-61. doi: 10.1111/cge.12394. Epub 2014 Apr 29.
• [16] Increased levels of statin, a marker of cell cycle arrest, in response to hippocampal neuronal injury.Brain Res Mol Brain Res. 1995 Dec 1;34(1):57-64. doi: 10.1016/0169-328x(95)00134-e.
• [17] A large scale proteome analysis of the gefitinib primary resistance overcome by KDAC inhibition in KRAS mutated adenocarcinoma cells overexpressing amphiregulin.J Proteomics. 2019 Mar 20;195:114-124. doi: 10.1016/j.jprot.2019.01.009. Epub 2019 Jan 17.
• [18] Revealing a Role for NMDA Receptors in Regulating STN Inputs following the Loss of Dopamine.Neuron. 2017 Sep 13;95(6):1227-1229. doi: 10.1016/j.neuron.2017.08.041.
• [19] Eef1a2 promotes cell growth, inhibits apoptosis and activates JAK/STAT and AKT signaling in mouse plasmacytomas.PLoS One. 2010 May 21;5(5):e10755. doi: 10.1371/journal.pone.0010755.
• [20] The EEF1A2 gene expression as risk predictor in localized prostate cancer.BMC Urol. 2017 Sep 18;17(1):86. doi: 10.1186/s12894-017-0278-3.
• [21] Neuropsychiatric complications and neuroimaging characteristics after deep brain stimulation surgery for Parkinson's disease.Brain Imaging Behav. 2020 Feb;14(1):62-71. doi: 10.1007/s11682-018-9971-4.
• [22] Improvement of Subthalamic Nucleus Deep Brain Stimulation in Sleeping Symptoms in Parkinson's Disease: A Meta-Analysis.Parkinsons Dis. 2019 Oct 8;2019:6280896. doi: 10.1155/2019/6280896. eCollection 2019.
• [23] Overexpression of eukaryotic elongation factor 1 alpha-2 is associated with poorer prognosis in patients with gastric cancer.J Cancer Res Clin Oncol. 2015 Jul;141(7):1265-75. doi: 10.1007/s00432-014-1897-7. Epub 2015 Jan 20.
• [24] Association of a four-amino acid residue insertion polymorphism of the HS1 gene with systemic lupus erythematosus: molecular and functional analysis.Arthritis Rheum. 2004 Mar;50(3):871-81. doi: 10.1002/art.20192.
• [25] Deep brain stimulation modulates pallidal and subthalamic neural oscillations in Tourette's syndrome.Brain Behav. 2019 Dec;9(12):e01450. doi: 10.1002/brb3.1450. Epub 2019 Oct 24.
• [26] Elevated levels of eEF1A2 protein expression in triple negative breast cancer relate with poor prognosis.PLoS One. 2019 Jun 20;14(6):e0218030. doi: 10.1371/journal.pone.0218030. eCollection 2019.
• [27] Diagnostic exome sequencing provides a molecular diagnosis for a significant proportion of patients with epilepsy. Genet Med. 2016 Sep;18(9):898-905. doi: 10.1038/gim.2015.186. Epub 2016 Jan 21.
• [28] Identification of putative oncogenes in lung adenocarcinoma by a comprehensive functional genomic approach.Oncogene. 2006 Apr 27;25(18):2628-35. doi: 10.1038/sj.onc.1209289.
• [29] Binding of eEF1A2 to the RNA-dependent protein kinase PKR modulates its activity and promotes tumour cell survival.Br J Cancer. 2018 Nov;119(11):1410-1420. doi: 10.1038/s41416-018-0336-y. Epub 2018 Nov 13.
• [30] Exome sequencing reveals new causal mutations in children with epileptic encephalopathies. Epilepsia. 2013 Jul;54(7):1270-81. doi: 10.1111/epi.12201. Epub 2013 May 3.
• [31] Homozygous EEF1A2 mutation causes dilated cardiomyopathy, failure to thrive, global developmental delay, epilepsy and early death.Hum Mol Genet. 2017 Sep 15;26(18):3545-3552. doi: 10.1093/hmg/ddx239.
• [32] Acute response of non-motor symptoms to subthalamic deep brain stimulation in Parkinson's disease.Parkinsonism Relat Disord. 2017 Aug;41:113-117. doi: 10.1016/j.parkreldis.2017.05.003. Epub 2017 May 8.
• [33] Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
• [34] miR-663 attenuates tumor growth and invasiveness by targeting eEF1A2 in pancreatic cancer.Mol Cancer. 2015 Feb 13;14:37. doi: 10.1186/s12943-015-0315-3.
• [35] Comparing two randomized deep brain stimulation trials for Parkinson's disease.J Neurosurg. 2019 Apr 5;132(5):1376-1384. doi: 10.3171/2018.12.JNS182042.
• [36] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [37] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [38] Analysis of telomerase activity and RNA expression in a patient with acute promyelocytic leukemia treated with all-trans retinoic acid. Pediatr Blood Cancer. 2006 Apr;46(4):506-11. doi: 10.1002/pbc.20392.
• [39] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [40] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [41] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [42] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [43] Quantitative proteomic analysis of HepG2 cells treated with quercetin suggests IQGAP1 involved in quercetin-induced regulation of cell proliferation and migration. OMICS. 2009 Apr;13(2):93-103. doi: 10.1089/omi.2008.0075.
• [44] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [45] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [46] Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
• [47] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [48] Glucocorticoids inhibit cell death in ovarian cancer and up-regulate caspase inhibitor cIAP2. Clin Cancer Res. 2005 Sep 1;11(17):6325-32. doi: 10.1158/1078-0432.CCR-05-0182.
• [49] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [50] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [51] Resveratrol suppresses growth of human ovarian cancer cells in culture and in a murine xenograft model: eukaryotic elongation factor 1A2 as a potential target. Cancer Res. 2009 Sep 15;69(18):7449-58. doi: 10.1158/0008-5472.CAN-09-1266. Epub 2009 Sep 8.
• [52] Proteomic analysis of the cellular response to a potent sensitiser unveils the dynamics of haptenation in living cells. Toxicology. 2020 Dec 1;445:152603. doi: 10.1016/j.tox.2020.152603. Epub 2020 Sep 28.
• [53] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [54] Inhibition of neuroblastoma proliferation by PF-3758309, a small-molecule inhibitor that targets p21-activated kinase 4. Oncol Rep. 2017 Nov;38(5):2705-2716. doi: 10.3892/or.2017.5989. Epub 2017 Sep 22.
• [55] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [56] eEF1A2 siRNA Suppresses MPP(+)-Induced Activation of Akt and mTOR and Potentiates Caspase-3 Activation in a Parkinson's Disease Model. ScientificWorldJournal. 2023 Apr 3;2023:1335201. doi: 10.1155/2023/1335201. eCollection 2023.
• [57] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
• [58] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [59] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [60] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [61] The NRF2-mediated oxidative stress response pathway is associated with tumor cell resistance to arsenic trioxide across the NCI-60 panel. BMC Med Genomics. 2010 Aug 13;3:37. doi: 10.1186/1755-8794-3-37.