Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAEZ0KP)

• DOT Name: Transgelin (TAGLN)
• Synonyms: 22 kDa actin-binding protein; Protein WS3-10; Smooth muscle protein 22-alpha; SM22-alpha
• Gene Name: TAGLN
• UniProt ID: TAGL_HUMAN
• Pfam ID: PF00402 ; PF00307
• Sequence:
  MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGV
  ILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEG
  KDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMG
  SNRGASQAGMTGYGRPRQIIS
• Function: Actin cross-linking/gelling protein. Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence.

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Temozolomide	DMKECZD	Approved	Transgelin (TAGLN) affects the response to substance of Temozolomide.	[46]
DTI-015	DMXZRW0	Approved	Transgelin (TAGLN) affects the response to substance of DTI-015.	[46]
Mitoxantrone	DMM39BF	Approved	Transgelin (TAGLN) affects the response to substance of Mitoxantrone.	[47]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Transgelin (TAGLN).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Transgelin (TAGLN).	[35]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Transgelin (TAGLN).	[39]

65 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Transgelin (TAGLN).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Transgelin (TAGLN).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Transgelin (TAGLN).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Transgelin (TAGLN).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Transgelin (TAGLN).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Transgelin (TAGLN).	[7]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Transgelin (TAGLN).	[8]
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of Transgelin (TAGLN).	[9]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Transgelin (TAGLN).	[10]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Transgelin (TAGLN).	[11]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Transgelin (TAGLN).	[12]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Transgelin (TAGLN).	[13]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Transgelin (TAGLN).	[14]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Transgelin (TAGLN).	[15]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Transgelin (TAGLN).	[16]
Phenobarbital	DMXZOCG	Approved	Phenobarbital decreases the expression of Transgelin (TAGLN).	[4]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Transgelin (TAGLN).	[17]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Transgelin (TAGLN).	[18]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Transgelin (TAGLN).	[19]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Transgelin (TAGLN).	[20]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Transgelin (TAGLN).	[21]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of Transgelin (TAGLN).	[22]
Clozapine	DMFC71L	Approved	Clozapine decreases the expression of Transgelin (TAGLN).	[23]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol affects the expression of Transgelin (TAGLN).	[24]
Pioglitazone	DMKJ485	Approved	Pioglitazone decreases the expression of Transgelin (TAGLN).	[25]
Haloperidol	DM96SE0	Approved	Haloperidol decreases the expression of Transgelin (TAGLN).	[4]
Vitamin C	DMXJ7O8	Approved	Vitamin C increases the expression of Transgelin (TAGLN).	[26]
Fluoxetine	DM3PD2C	Approved	Fluoxetine decreases the expression of Transgelin (TAGLN).	[23]
Sertraline	DM0FB1J	Approved	Sertraline decreases the expression of Transgelin (TAGLN).	[23]
Ampicillin	DMHWE7P	Approved	Ampicillin increases the expression of Transgelin (TAGLN).	[10]
Tetracycline	DMZA017	Approved	Tetracycline decreases the expression of Transgelin (TAGLN).	[4]
Thioridazine	DM35M8J	Approved	Thioridazine decreases the expression of Transgelin (TAGLN).	[23]
Imipramine	DM2NUH3	Approved	Imipramine decreases the expression of Transgelin (TAGLN).	[23]
Clomipramine	DMINRKW	Approved	Clomipramine decreases the expression of Transgelin (TAGLN).	[4]
Citalopram	DM2G9AE	Approved	Citalopram decreases the expression of Transgelin (TAGLN).	[28]
Erythromycin	DM4K7GQ	Approved	Erythromycin decreases the expression of Transgelin (TAGLN).	[28]
Loratadine	DMF3AN7	Approved	Loratadine decreases the expression of Transgelin (TAGLN).	[23]
Quinidine	DMLPICK	Approved	Quinidine decreases the expression of Transgelin (TAGLN).	[28]
Flecainide	DMSQDLE	Approved	Flecainide decreases the expression of Transgelin (TAGLN).	[4]
Perhexiline	DMINO7Z	Approved	Perhexiline decreases the expression of Transgelin (TAGLN).	[23]
Doxepin	DMPI98T	Approved	Doxepin decreases the expression of Transgelin (TAGLN).	[28]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Transgelin (TAGLN).	[29]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Transgelin (TAGLN).	[12]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene affects the expression of Transgelin (TAGLN).	[30]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol decreases the expression of Transgelin (TAGLN).	[31]
Chlorpromazine	DMBGZI3	Phase 3 Trial	Chlorpromazine decreases the expression of Transgelin (TAGLN).	[4]
Coprexa	DMA0WEK	Phase 3	Coprexa increases the expression of Transgelin (TAGLN).	[32]
NVP-LAQ824	DM8JWNA	Phase 3	NVP-LAQ824 increases the expression of Transgelin (TAGLN).	[20]
Genistein	DM0JETC	Phase 2/3	Genistein affects the expression of Transgelin (TAGLN).	[24]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone decreases the expression of Transgelin (TAGLN).	[4]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Transgelin (TAGLN).	[33]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate decreases the expression of Transgelin (TAGLN).	[34]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Transgelin (TAGLN).	[36]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Transgelin (TAGLN).	[37]
Chlorcyclizine	DM3L52Q	Phase 1	Chlorcyclizine decreases the expression of Transgelin (TAGLN).	[23]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Transgelin (TAGLN).	[38]
ZIMELIDINE	DMNI3U2	Withdrawn from market	ZIMELIDINE decreases the expression of Transgelin (TAGLN).	[23]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Transgelin (TAGLN).	[40]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Transgelin (TAGLN).	[41]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Transgelin (TAGLN).	[42]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Transgelin (TAGLN).	[43]
Resorcinol	DMM37C0	Investigative	Resorcinol decreases the expression of Transgelin (TAGLN).	[45]
U0126	DM31OGF	Investigative	U0126 increases the expression of Transgelin (TAGLN).	[15]
Bisindolylmaleimide-I	DMOQJZC	Investigative	Bisindolylmaleimide-I decreases the expression of Transgelin (TAGLN).	[34]
Go 6983	DMKVTZN	Investigative	Go 6983 decreases the expression of Transgelin (TAGLN).	[34]

2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Dihydroartemisinin	DMBXVMZ	Approved	Dihydroartemisinin affects the binding of Transgelin (TAGLN).	[27]
D-glucose	DMMG2TO	Investigative	D-glucose increases the secretion of Transgelin (TAGLN).	[44]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Cyclosporine A--induced oxidative stress in human renal mesangial cells: a role for ERK 1/2 MAPK signaling. Toxicol Sci. 2012 Mar;126(1):101-13.
• [3] Differentiation of human embryonic stem cells into smooth muscle cells in adherent monolayer culture. Biochem Biophys Res Commun. 2006 Dec 15;351(2):321-7. doi: 10.1016/j.bbrc.2006.09.171. Epub 2006 Oct 17.
• [4] Determination of phospholipidosis potential based on gene expression analysis in HepG2 cells. Toxicol Sci. 2007 Mar;96(1):101-14.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [8] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [9] Drinking-water arsenic exposure modulates gene expression in human lymphocytes from a U.S. population. Environ Health Perspect. 2008 Apr;116(4):524-31. doi: 10.1289/ehp.10861.
• [10] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [11] Unique signatures of stress-induced senescent human astrocytes. Exp Neurol. 2020 Dec;334:113466. doi: 10.1016/j.expneurol.2020.113466. Epub 2020 Sep 17.
• [12] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [13] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [14] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [15] Folate deficiency in normal human fibroblasts leads to altered expression of genes primarily linked to cell signaling, the cytoskeleton and extracellular matrix. J Nutr Biochem. 2007 Aug;18(8):541-52. doi: 10.1016/j.jnutbio.2006.11.002. Epub 2007 Feb 22.
• [16] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [17] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [18] Dissecting progressive stages of 5-fluorouracil resistance in vitro using RNA expression profiling. Int J Cancer. 2004 Nov 1;112(2):200-12. doi: 10.1002/ijc.20401.
• [19] Folic acid induces cell type-specific changes in the transcriptome of breast cancer cell lines: a proof-of-concept study. J Nutr Sci. 2016 Apr 26;5:e17. doi: 10.1017/jns.2016.8. eCollection 2016.
• [20] Antitumor effect of the histone deacetylase inhibitor LAQ824 in combination with 13-cis-retinoic acid in human malignant melanoma. Mol Cancer Ther. 2007 Jan;6(1):70-81. doi: 10.1158/1535-7163.MCT-06-0125.
• [21] Cardiac toxicity from ethanol exposure in human-induced pluripotent stem cell-derived cardiomyocytes. Toxicol Sci. 2019 May 1;169(1):280-292.
• [22] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [23] A toxicogenomic approach to drug-induced phospholipidosis: analysis of its induction mechanism and establishment of a novel in vitro screening system. Toxicol Sci. 2005 Feb;83(2):282-92.
• [24] Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
• [25] Peroxisome proliferator activated receptor gamma (PPAR-gama) ligand pioglitazone regulated gene networks in term human primary trophoblast cells. Reprod Toxicol. 2018 Oct;81:99-107.
• [26] Effects of transforming growth factor-beta 1 and ascorbic acid on differentiation of human bone-marrow-derived mesenchymal stem cells into smooth muscle cell lineage. Cell Tissue Res. 2008 Sep;333(3):449-59. doi: 10.1007/s00441-008-0654-0. Epub 2008 Jul 8.
• [27] Untargeted Proteomics and Systems-Based Mechanistic Investigation of Artesunate in Human Bronchial Epithelial Cells. Chem Res Toxicol. 2015 Oct 19;28(10):1903-13. doi: 10.1021/acs.chemrestox.5b00105. Epub 2015 Sep 21.
• [28] In vitro detection of drug-induced phospholipidosis using gene expression and fluorescent phospholipid based methodologies. Toxicol Sci. 2007 Sep;99(1):162-73.
• [29] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [30] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [31] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [32] Copper deprivation enhances the chemosensitivity of pancreatic cancer to rapamycin by mTORC1/2 inhibition. Chem Biol Interact. 2023 Sep 1;382:110546. doi: 10.1016/j.cbi.2023.110546. Epub 2023 Jun 7.
• [33] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [34] Possible involvement of protein kinase C activation in differentiation of human umbilical vein endothelium-derived cell into smooth muscle-like cell. Biol Cell. 2004 Sep;96(7):499-508. doi: 10.1016/j.biolcel.2004.04.012.
• [35] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [36] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [37] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [38] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [39] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [40] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [41] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [42] Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
• [43] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [44] Calorie restriction-induced changes in the secretome of human adipocytes, comparison with resveratrol-induced secretome effects. Biochim Biophys Acta. 2014 Sep;1844(9):1511-22. doi: 10.1016/j.bbapap.2014.04.023. Epub 2014 May 5.
• [45] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [46] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.
• [47] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.