Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAKDNSM)

DOT Name Sclerostin domain-containing protein 1 (SOSTDC1)
Synonyms Ectodermal BMP inhibitor; Ectodin; Uterine sensitization-associated gene 1 protein; USAG-1
Gene Name SOSTDC1
Related Disease
Thyroid cancer ( )
Thyroid gland carcinoma ( )
Thyroid tumor ( )
Type-1 diabetes ( )
Allergic rhinitis ( )
Alport syndrome ( )
Anxiety ( )
Anxiety disorder ( )
Asthma ( )
Atopic dermatitis ( )
Bipolar disorder ( )
Bone disease ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Carcinoma ( )
Clear cell renal carcinoma ( )
Coronary atherosclerosis ( )
Depression ( )
Disorder of orbital region ( )
Gastric cancer ( )
Gastric neoplasm ( )
Huntington disease ( )
Lung cancer ( )
Lung carcinoma ( )
Major depressive disorder ( )
Myocardial infarction ( )
Neoplasm ( )
Nephropathy ( )
Non-small-cell lung cancer ( )
Onchocerciasis ( )
Peters anomaly ( )
Primary hyperoxaluria type 1 ( )
Renal carcinoma ( )
Stomach cancer ( )
Advanced cancer ( )
Myocardial ischemia ( )
Peripheral arterial disease ( )
Plasma cell myeloma ( )
Thyroid gland follicular carcinoma ( )
Coronary heart disease ( )
Childhood kidney Wilms tumor ( )
Chronic kidney disease ( )
Kidney cancer ( )
Prostate cancer ( )
Prostate carcinoma ( )
Wilms tumor ( )
UniProt ID
SOSD1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF05463
Sequence
MLPPAIHFYLLPLACILMKSCLAFKNDATEILYSHVVKPVPAHPSSNSTLNQARNGGRHF
SNTGLDRNTRVQVGCRELRSTKYISDGQCTSISPLKELVCAGECLPLPVLPNWIGGGYGT
KYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFE
SMSPAKPVQHHRERKRASKSSKHSMS
Function
May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction Enhances Wnt signaling and inhibits TGF-beta signaling. Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner.
Tissue Specificity Highly expressed in kidney and weakly in lung.

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Thyroid cancer DIS3VLDH Definitive Altered Expression [1]
Thyroid gland carcinoma DISMNGZ0 Definitive Altered Expression [1]
Thyroid tumor DISLVKMD Definitive Altered Expression [1]
Type-1 diabetes DIS7HLUB Definitive Biomarker [2]
Allergic rhinitis DIS3U9HN Strong Biomarker [3]
Alport syndrome DIS25AB4 Strong Biomarker [4]
Anxiety DISIJDBA Strong Biomarker [5]
Anxiety disorder DISBI2BT Strong Biomarker [5]
Asthma DISW9QNS Strong Biomarker [3]
Atopic dermatitis DISTCP41 Strong Biomarker [6]
Bipolar disorder DISAM7J2 Strong Biomarker [7]
Bone disease DISE1F82 Strong Biomarker [8]
Breast cancer DIS7DPX1 Strong Altered Expression [9]
Breast carcinoma DIS2UE88 Strong Altered Expression [9]
Breast neoplasm DISNGJLM Strong Biomarker [10]
Carcinoma DISH9F1N Strong Biomarker [11]
Clear cell renal carcinoma DISBXRFJ Strong Biomarker [11]
Coronary atherosclerosis DISKNDYU Strong Genetic Variation [12]
Depression DIS3XJ69 Strong Biomarker [5]
Disorder of orbital region DISH0ECJ Strong Biomarker [13]
Gastric cancer DISXGOUK Strong Altered Expression [14]
Gastric neoplasm DISOKN4Y Strong Biomarker [14]
Huntington disease DISQPLA4 Strong Altered Expression [15]
Lung cancer DISCM4YA Strong Genetic Variation [16]
Lung carcinoma DISTR26C Strong Genetic Variation [16]
Major depressive disorder DIS4CL3X Strong Biomarker [17]
Myocardial infarction DIS655KI Strong Genetic Variation [18]
Neoplasm DISZKGEW Strong Biomarker [19]
Nephropathy DISXWP4P Strong Biomarker [4]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [20]
Onchocerciasis DISEPYEA Strong Biomarker [21]
Peters anomaly DISERK0M Strong Altered Expression [13]
Primary hyperoxaluria type 1 DISS210K Strong Altered Expression [22]
Renal carcinoma DISER9XT Strong Altered Expression [23]
Stomach cancer DISKIJSX Strong Altered Expression [14]
Advanced cancer DISAT1Z9 moderate Biomarker [24]
Myocardial ischemia DISFTVXF moderate Biomarker [25]
Peripheral arterial disease DIS78WFB moderate Biomarker [26]
Plasma cell myeloma DIS0DFZ0 moderate Altered Expression [27]
Thyroid gland follicular carcinoma DISFK2QT moderate Biomarker [28]
Coronary heart disease DIS5OIP1 Disputed Genetic Variation [12]
Childhood kidney Wilms tumor DIS0NMK3 Limited Genetic Variation [29]
Chronic kidney disease DISW82R7 Limited Biomarker [30]
Kidney cancer DISBIPKM Limited Biomarker [31]
Prostate cancer DISF190Y Limited Posttranslational Modification [32]
Prostate carcinoma DISMJPLE Limited Posttranslational Modification [32]
Wilms tumor DISB6T16 Limited Genetic Variation [29]
------------------------------------------------------------------------------------
⏷ Show the Full List of 47 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Sclerostin domain-containing protein 1 (SOSTDC1). [33]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Sclerostin domain-containing protein 1 (SOSTDC1). [34]
Estradiol DMUNTE3 Approved Estradiol affects the expression of Sclerostin domain-containing protein 1 (SOSTDC1). [35]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Sclerostin domain-containing protein 1 (SOSTDC1). [36]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Sclerostin domain-containing protein 1 (SOSTDC1). [37]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Sclerostin domain-containing protein 1 (SOSTDC1). [38]
Ethinyl estradiol DMODJ40 Approved Ethinyl estradiol affects the expression of Sclerostin domain-containing protein 1 (SOSTDC1). [39]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Sclerostin domain-containing protein 1 (SOSTDC1). [40]
Genistein DM0JETC Phase 2/3 Genistein affects the expression of Sclerostin domain-containing protein 1 (SOSTDC1). [39]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Sclerostin domain-containing protein 1 (SOSTDC1). [42]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Sclerostin domain-containing protein 1 (SOSTDC1). [44]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Sclerostin domain-containing protein 1 (SOSTDC1). [41]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Sclerostin domain-containing protein 1 (SOSTDC1). [43]
------------------------------------------------------------------------------------

References

1 E4BP4 promotes thyroid cancer proliferation by modulating iron homeostasis through repression of hepcidin.Cell Death Dis. 2018 Sep 24;9(10):987. doi: 10.1038/s41419-018-1001-3.
2 Prefronto-temporal white matter microstructural alterations 20years after the diagnosis of type 1 diabetes mellitus.Pediatr Diabetes. 2018 May;19(3):478-485. doi: 10.1111/pedi.12574. Epub 2017 Sep 20.
3 Introduction.Adv Exp Med Biol. 2017;1027:1-10. doi: 10.1007/978-3-319-64804-0_1.
4 Loss of the BMP antagonist USAG-1 ameliorates disease in a mouse model of the progressive hereditary kidney disease Alport syndrome.J Clin Invest. 2010 Mar;120(3):768-77. doi: 10.1172/JCI39569. Epub 2010 Feb 8.
5 Inflammatory markers as predictors of depression and anxiety in adolescents: Statistical model building with component-wise gradient boosting.J Affect Disord. 2018 Jul;234:276-281. doi: 10.1016/j.jad.2018.03.006. Epub 2018 Mar 12.
6 The history of atopic dermatitis.Clin Dermatol. 2017 Jul-Aug;35(4):344-348. doi: 10.1016/j.clindermatol.2017.03.005. Epub 2017 Mar 23.
7 Altered DLPFC-Hippocampus Connectivity During Working Memory: Independent Replication and Disorder Specificity of a Putative Genetic Risk Phenotype for Schizophrenia.Schizophr Bull. 2017 Sep 1;43(5):1114-1122. doi: 10.1093/schbul/sbx001.
8 Wnt Antagonists in Hematopoietic and Immune Cell Fate: Implications for Osteoporosis Therapies.Curr Osteoporos Rep. 2019 Apr;17(2):49-58. doi: 10.1007/s11914-019-00503-3.
9 E4BP4 is a repressor of epigenetically regulated SOSTDC1 expression in breast cancer cells.Cell Oncol (Dordr). 2014 Dec;37(6):409-19. doi: 10.1007/s13402-014-0204-6. Epub 2014 Oct 22.
10 Batwing versus Wise pattern mammoplasty for upper pole breast tumours: a detailed comparison of cosmetic outcome.World J Surg Oncol. 2017 Mar 14;15(1):60. doi: 10.1186/s12957-017-1124-5.
11 A human bone morphogenetic protein antagonist is down-regulated in renal cancer.Mol Biol Cell. 2008 Feb;19(2):457-64. doi: 10.1091/mbc.e07-05-0433. Epub 2007 Nov 21.
12 Left ventricular concentric remodelling and functional impairment in women with ischaemia with no obstructive coronary artery disease and intermediate coronary flow reserve: a report from the WISE-CVD study.Eur Heart J Cardiovasc Imaging. 2019 Aug 1;20(8):875-882. doi: 10.1093/ehjci/jez044.
13 Sostdc1 is expressed in all major compartments of developing and adult mammalian eyes.Graefes Arch Clin Exp Ophthalmol. 2019 Nov;257(11):2401-2427. doi: 10.1007/s00417-019-04462-4. Epub 2019 Sep 16.
14 SOSTDC1 down-regulation of expression involves CpG methylation and is a potential prognostic marker in gastric cancer.Cancer Genet. 2013 May;206(5):174-82. doi: 10.1016/j.cancergen.2013.04.005. Epub 2013 Jul 5.
15 Population-specific genetic modification of Huntington's disease in Venezuela.PLoS Genet. 2018 May 11;14(5):e1007274. doi: 10.1371/journal.pgen.1007274. eCollection 2018 May.
16 Changes in gene expression in lungs of mice exposed to traffic-related air pollution.Mol Cell Probes. 2018 Jun;39:33-40. doi: 10.1016/j.mcp.2018.03.005. Epub 2018 Apr 3.
17 Striatal dopamine deficits predict reductions in striatal functional connectivity in major depression: a concurrent (11)C-raclopride positron emission tomography and functional magnetic resonance imaging investigation.Transl Psychiatry. 2018 Nov 30;8(1):264. doi: 10.1038/s41398-018-0316-2.
18 Independent Modular Filter for Embolic Protection in Carotid Stenting.Circ Cardiovasc Interv. 2017 Mar;10(3):e004244. doi: 10.1161/CIRCINTERVENTIONS.116.004244.
19 Personalized oncology with artificial intelligence: The case of temozolomide.Artif Intell Med. 2019 Aug;99:101693. doi: 10.1016/j.artmed.2019.07.001. Epub 2019 Aug 12.
20 SOSTDC1 inhibits bone metastasis in non-small cell lung cancer and may serve as a clinical therapeutic target.Int J Mol Med. 2018 Dec;42(6):3424-3436. doi: 10.3892/ijmm.2018.3926. Epub 2018 Oct 10.
21 Taxonomy and polytene chromosomes of the Neotropical black fly Simulium perplexum (Diptera: Simuliidae).Acta Trop. 2017 Jul;171:101-113. doi: 10.1016/j.actatropica.2017.03.024. Epub 2017 Mar 27.
22 Identification of mutations associated with peroxisome-to-mitochondrion mistargeting of alanine/glyoxylate aminotransferase in primary hyperoxaluria type 1.J Cell Biol. 1990 Dec;111(6 Pt 1):2341-51. doi: 10.1083/jcb.111.6.2341.
23 Loss of heterozygosity and SOSTDC1 in adult and pediatric renal tumors.J Exp Clin Cancer Res. 2010 Nov 16;29(1):147. doi: 10.1186/1756-9966-29-147.
24 The first report of a 5-year period cancer registry in Greece (2009-2013): a pathology-based cancer registry.Virchows Arch. 2018 Apr;472(4):677-682. doi: 10.1007/s00428-017-2287-8. Epub 2018 Jan 4.
25 Acetylcholine versus cold pressor testing for evaluation of coronary endothelial function.PLoS One. 2017 Feb 16;12(2):e0172538. doi: 10.1371/journal.pone.0172538. eCollection 2017.
26 WIRION Embolic Protection System in Lower Extremity Arterial Interventions: Results of the Pivotal WISE LE Trial.JACC Cardiovasc Interv. 2018 Oct 8;11(19):1995-2003. doi: 10.1016/j.jcin.2018.05.025.
27 Sostdc1: A soluble BMP and Wnt antagonist that is induced by the interaction between myeloma cells and osteoblast lineage cells.Bone. 2019 May;122:82-92. doi: 10.1016/j.bone.2019.02.012. Epub 2019 Feb 15.
28 SOSTDC1 inhibits follicular thyroid cancer cell proliferation, migration, and EMT via suppressing PI3K/Akt and MAPK/Erk signaling pathways.Mol Cell Biochem. 2017 Nov;435(1-2):87-95. doi: 10.1007/s11010-017-3059-0. Epub 2017 May 27.
29 Two candidate tumor suppressor genes, MEOX2 and SOSTDC1, identified in a 7p21 homozygous deletion region in a Wilms tumor.Genes Chromosomes Cancer. 2009 Dec;48(12):1037-50. doi: 10.1002/gcc.20705.
30 Febuxostat inhibits TGF?induced epithelialmesenchymal transition via downregulation of USAG? expression in MadinDarby canine kidney cells invitro.Mol Med Rep. 2019 Mar;19(3):1694-1704. doi: 10.3892/mmr.2019.9806. Epub 2019 Jan 2.
31 Defining Signatures of Arm-Wise Copy Number Change and Their Associated Drivers in Kidney Cancers.Int J Mol Sci. 2019 Nov 16;20(22):5762. doi: 10.3390/ijms20225762.
32 Hepcidin regulation in prostate and its disruption in prostate cancer.Cancer Res. 2015 Jun 1;75(11):2254-63. doi: 10.1158/0008-5472.CAN-14-2465. Epub 2015 Apr 9.
33 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
34 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
35 Estradiol and selective estrogen receptor modulators differentially regulate target genes with estrogen receptors alpha and beta. Mol Biol Cell. 2004 Mar;15(3):1262-72. doi: 10.1091/mbc.e03-06-0360. Epub 2003 Dec 29.
36 Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
37 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
38 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
39 Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
40 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
41 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
42 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
43 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
44 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.