Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCEJ8W5)

• DOT Name: BMP and activin membrane-bound inhibitor homolog (BAMBI)
• Synonyms: Non-metastatic gene A protein; Putative transmembrane protein NMA
• Gene Name: BAMBI
• Related Disease:
  Neuroblastoma
  Arteriosclerosis
  Atherosclerosis
  Benign prostatic hyperplasia
  Bladder cancer
  Carcinoma
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Desmoid tumour
  Diamond-Blackfan anemia
  Fatty liver disease
  Glioma
  Hepatitis
  Hepatitis B virus infection
  Influenza
  Liver cirrhosis
  Lung cancer
  Lung carcinoma
  Metastatic malignant neoplasm
  Mucinous adenocarcinoma
  Non-small-cell lung cancer
  Obesity
  Urinary bladder cancer
  Urinary bladder neoplasm
  Cherubism
  Chronic obstructive pulmonary disease
  Gastric cancer
  Hepatocellular carcinoma
  Immune system disorder
  Stomach cancer
  Renal tubular acidosis
  Cardiac failure
  Congestive heart failure
  Epithelial ovarian cancer
  Graft-versus-host disease
  Intellectual disability
  Ovarian cancer
  Ovarian neoplasm
• UniProt ID: BAMBI_HUMAN
• Pfam ID: PF06211 ; PF19337
• Sequence:
  MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQN
  SNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEA
  SGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSEN
  KRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSND
  KILSLVHWGMYSGHGKLEFV
• Function: Negatively regulates TGF-beta signaling.
• Tissue Specificity: High expression in kidney medulla, placenta and spleen; low in kidney cortex, liver, prostate and gut. Not expressed in normal skin, expression is high in melanocytes and in 3 out of 11 melanoma metastases tested.
• KEGG Pathway:
  Wnt sig.ling pathway (hsa04310)
  TGF-beta sig.ling pathway (hsa04350)
• Reactome Pathway: Downregulation of TGF-beta receptor signaling (R-HSA-2173788)

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neuroblastoma	DISVZBI4	Definitive	Biomarker	[1]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[2]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[2]
Benign prostatic hyperplasia	DISI3CW2	Strong	Altered Expression	[3]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[4]
Carcinoma	DISH9F1N	Strong	Biomarker	[5]
Colon cancer	DISVC52G	Strong	Altered Expression	[5]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[5]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[6]
Desmoid tumour	DISGX357	Strong	Altered Expression	[7]
Diamond-Blackfan anemia	DISI2SNW	Strong	Biomarker	[8]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[9]
Glioma	DIS5RPEH	Strong	Altered Expression	[10]
Hepatitis	DISXXX35	Strong	Biomarker	[9]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[11]
Influenza	DIS3PNU3	Strong	Altered Expression	[12]
Liver cirrhosis	DIS4G1GX	Strong	Biomarker	[11]
Lung cancer	DISCM4YA	Strong	Altered Expression	[13]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[13]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[5]
Mucinous adenocarcinoma	DISKNFE8	Strong	Biomarker	[14]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[13]
Obesity	DIS47Y1K	Strong	Biomarker	[15]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[4]
Urinary bladder neoplasm	DIS7HACE	Strong	Posttranslational Modification	[4]
Cherubism	DISHLJI0	moderate	Altered Expression	[16]
Chronic obstructive pulmonary disease	DISQCIRF	moderate	Altered Expression	[17]
Gastric cancer	DISXGOUK	moderate	Altered Expression	[18]
Hepatocellular carcinoma	DIS0J828	moderate	Altered Expression	[19]
Immune system disorder	DISAEGPH	moderate	Biomarker	[20]
Stomach cancer	DISKIJSX	moderate	Altered Expression	[18]
Renal tubular acidosis	DISE1NDR	Disputed	Biomarker	[21]
Cardiac failure	DISDC067	Limited	Biomarker	[22]
Congestive heart failure	DIS32MEA	Limited	Biomarker	[22]
Epithelial ovarian cancer	DIS56MH2	Limited	Biomarker	[23]
Graft-versus-host disease	DIS0QADF	Limited	Biomarker	[24]
Intellectual disability	DISMBNXP	Limited	Genetic Variation	[25]
Ovarian cancer	DISZJHAP	Limited	Biomarker	[23]
Ovarian neoplasm	DISEAFTY	Limited	Biomarker	[23]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Etoposide	DMNH3PG	Approved	BMP and activin membrane-bound inhibitor homolog (BAMBI) affects the response to substance of Etoposide.	[58]
Mitomycin	DMH0ZJE	Approved	BMP and activin membrane-bound inhibitor homolog (BAMBI) affects the response to substance of Mitomycin.	[58]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[26]

34 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[27]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[28]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[29]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[30]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[31]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[32]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[33]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[34]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[35]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[36]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[37]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[38]
Menadione	DMSJDTY	Approved	Menadione affects the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[37]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[39]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[40]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[41]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[42]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[43]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[44]
Isoflavone	DM7U58J	Phase 4	Isoflavone increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[45]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[39]
Phenol	DM1QSM3	Phase 2/3	Phenol increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[46]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[43]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[47]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[48]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[49]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[50]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[51]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[52]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[53]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[54]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[55]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[56]
Resorcinol	DMM37C0	Investigative	Resorcinol decreases the expression of BMP and activin membrane-bound inhibitor homolog (BAMBI).	[57]

References

• [1] Downregulation of Axl in non-MYCN amplified neuroblastoma cell lines reduces migration.Gene. 2013 May 25;521(1):62-8. doi: 10.1016/j.gene.2013.03.029. Epub 2013 Mar 21.
• [2] microRNA-338-3p promotes ox-LDL-induced endothelial cell injury through targeting BAMBI and activating TGF-/Smad pathway.J Cell Physiol. 2019 Jul;234(7):11577-11586. doi: 10.1002/jcp.27814. Epub 2018 Dec 17.
• [3] Kangquan Recipe Regulates the Expression of BAMBI Protein via the TGF-/Smad Signaling Pathway to Inhibit Benign Prostatic Hyperplasia in Rats.Evid Based Complement Alternat Med. 2019 May 2;2019:6281819. doi: 10.1155/2019/6281819. eCollection 2019.
• [4] BAMBI gene is epigenetically silenced in subset of high-grade bladder cancer.Int J Cancer. 2009 Jul 15;125(2):328-38. doi: 10.1002/ijc.24318.
• [5] A colorectal cancer expression profile that includes transforming growth factor beta inhibitor BAMBI predicts metastatic potential.Gastroenterology. 2009 Jul;137(1):165-75. doi: 10.1053/j.gastro.2009.03.041. Epub 2009 Mar 26.
• [6] Polymorphisms in the transforming growth factor beta 1 pathway in relation to colorectal cancer progression.Genes Chromosomes Cancer. 2010 Mar;49(3):270-81. doi: 10.1002/gcc.20738.
• [7] Desmoid tumor with ossification in chest wall: possible involvement of BAMBI promoter hypermethylation in metaplastic bone formation.J Bone Miner Res. 2005 Aug;20(8):1472-7. doi: 10.1359/jbmr.2005.20.8.1472. Epub 2005 Mar 21.
• [8] Dysregulation of the Transforming Growth Factor Pathway in Induced Pluripotent Stem Cells Generated from Patients with Diamond Blackfan Anemia.PLoS One. 2015 Aug 10;10(8):e0134878. doi: 10.1371/journal.pone.0134878. eCollection 2015.
• [9] Adiponectin induces the transforming growth factor decoy receptor BAMBI in human hepatocytes.FEBS Lett. 2011 May 6;585(9):1338-44. doi: 10.1016/j.febslet.2011.04.003. Epub 2011 Apr 7.
• [10] BAMBI promotes macrophage proliferation and differentiation in gliomas.Mol Med Rep. 2018 Mar;17(3):3960-3966. doi: 10.3892/mmr.2017.8320. Epub 2017 Dec 20.
• [11] MicroRNA-942 mediates hepatic stellate cell activation by regulating BAMBI expression in human liver fibrosis.Arch Toxicol. 2018 Sep;92(9):2935-2946. doi: 10.1007/s00204-018-2278-9. Epub 2018 Aug 10.
• [12] The TGF-beta-pseudoreceptor BAMBI is strongly expressed in COPD lungs and regulated by nontypeable Haemophilus influenzae.Respir Res. 2010 May 31;11(1):67. doi: 10.1186/1465-9921-11-67.
• [13] Downregulation of the TGF Pseudoreceptor BAMBI in Non-Small Cell Lung Cancer Enhances TGF Signaling and Invasion.Cancer Res. 2016 Jul 1;76(13):3785-801. doi: 10.1158/0008-5472.CAN-15-1326. Epub 2016 May 17.
• [14] Prognostic value of mucinous histology depends on microsatellite instability status in patients with stage III colon cancer treated with adjuvant FOLFOX chemotherapy: a retrospective cohort study.Ann Surg Oncol. 2013 Oct;20(11):3407-13. doi: 10.1245/s10434-013-3169-1. Epub 2013 Aug 14.
• [15] Investigation of common and rare genetic variation in the BAMBI genomic region in light of human obesity.Endocrine. 2016 May;52(2):277-86. doi: 10.1007/s12020-015-0778-4. Epub 2015 Oct 26.
• [16] Rescue of a cherubism bone marrow stromal culture phenotype by reducing TGF signaling.Bone. 2018 Jun;111:28-35. doi: 10.1016/j.bone.2018.03.009. Epub 2018 Mar 9.
• [17] TGF-/BAMBI pathway dysfunction contributes to peripheral Th17/Treg imbalance in chronic obstructive pulmonary disease.Sci Rep. 2016 Aug 23;6:31911. doi: 10.1038/srep31911.
• [18] BMP8B Is a Tumor Suppressor Gene Regulated by Histone Acetylation in Gastric Cancer.J Cell Biochem. 2017 Apr;118(4):869-877. doi: 10.1002/jcb.25766. Epub 2016 Nov 10.
• [19] MiR-HCC2 Up-regulates BAMBI and ELMO1 Expression to Facilitate the Proliferation and EMT of Hepatocellular Carcinoma Cells.J Cancer. 2019 Jun 9;10(15):3407-3419. doi: 10.7150/jca.30858. eCollection 2019.
• [20] Cytokine-induced alterations of BAMBI mediate the reciprocal regulation of human Th17/Tregcells in response to cigarette smoke extract.Int J Mol Med. 2018 Dec;42(6):3404-3414. doi: 10.3892/ijmm.2018.3919. Epub 2018 Oct 9.
• [21] Molecular modelling and dynamics of CA2 missense mutations causative to carbonic anhydrase 2 deficiency syndrome.J Biomol Struct Dyn. 2020 Sep;38(14):4067-4080. doi: 10.1080/07391102.2019.1671899. Epub 2019 Oct 8.
• [22] A context-specific cardiac -catenin and GATA4 interaction influences TCF7L2 occupancy and remodels chromatin driving disease progression in the adult heart.Nucleic Acids Res. 2018 Apr 6;46(6):2850-2867. doi: 10.1093/nar/gky049.
• [23] BAMBI is overexpressed in ovarian cancer and co-translocates with Smads into the nucleus upon TGF-beta treatment.Gynecol Oncol. 2010 May;117(2):189-97. doi: 10.1016/j.ygyno.2009.12.034. Epub 2010 Feb 26.
• [24] Shortened-Duration Tacrolimus after Nonmyeloablative, HLA-Haploidentical Bone Marrow Transplantation.Biol Blood Marrow Transplant. 2018 May;24(5):1022-1028. doi: 10.1016/j.bbmt.2018.01.011. Epub 2018 Jan 17.
• [25] Deletion at chromosome 10p11.23-p12.1 defines characteristic phenotypes with marked midface retrusion.J Hum Genet. 2012 Mar;57(3):191-6. doi: 10.1038/jhg.2011.154. Epub 2012 Jan 19.
• [26] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [27] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [28] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [29] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [30] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [31] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [32] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [33] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [34] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [35] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [36] Changes in gene expression profiles of multiple myeloma cells induced by arsenic trioxide (ATO): possible mechanisms to explain ATO resistance in vivo. Br J Haematol. 2005 Mar;128(5):636-44.
• [37] Time series analysis of oxidative stress response patterns in HepG2: a toxicogenomics approach. Toxicology. 2013 Apr 5;306:24-34.
• [38] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [39] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [40] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [41] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [42] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [43] Upregulation of genes orchestrating keratinocyte differentiation, including the novel marker gene ID2, by contact sensitizers in human bulge-derived keratinocytes. J Biochem Mol Toxicol. 2010 Jan-Feb;24(1):10-20.
• [44] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [45] Soy isoflavones exert differential effects on androgen responsive genes in LNCaP human prostate cancer cells. J Nutr. 2007 Apr;137(4):964-72.
• [46] Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
• [47] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [48] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [49] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [50] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [51] Low dose of bisphenol a modulates ovarian cancer gene expression profile and promotes epithelial to mesenchymal transition via canonical Wnt pathway. Toxicol Sci. 2018 Aug 1;164(2):527-538.
• [52] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [53] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [54] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [55] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [56] Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
• [57] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [58] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.