General Information of Drug Off-Target (DOT) (ID: OTCQJAB0)

DOT Name Baculoviral IAP repeat-containing protein 6 (BIRC6)
Synonyms EC 2.3.2.27; BIR repeat-containing ubiquitin-conjugating enzyme; BRUCE; RING-type E3 ubiquitin transferase BIRC6; Ubiquitin-conjugating BIR domain enzyme apollon; APOLLON
Gene Name BIRC6
Related Disease
Acute myelogenous leukaemia ( )
Prostate cancer ( )
Prostate carcinoma ( )
Acute leukaemia ( )
Acute lymphocytic leukaemia ( )
Acute monocytic leukemia ( )
Advanced cancer ( )
B-cell neoplasm ( )
Benign neoplasm ( )
Bone osteosarcoma ( )
Brain cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Carcinoma of liver and intrahepatic biliary tract ( )
Cardiac failure ( )
Castration-resistant prostate carcinoma ( )
Childhood acute lymphoblastic leukemia ( )
Colon cancer ( )
Colon carcinoma ( )
Colorectal carcinoma ( )
Congestive heart failure ( )
Epithelial ovarian cancer ( )
Esophageal squamous cell carcinoma ( )
Glaucoma/ocular hypertension ( )
Liver cancer ( )
Lung cancer ( )
Lung squamous cell carcinoma ( )
Melanoma ( )
Non-small-cell lung cancer ( )
Osteosarcoma ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Adult glioblastoma ( )
Glioblastoma multiforme ( )
Angle-closure glaucoma ( )
Polycystic kidney disease ( )
Primary angle-closure glaucoma ( )
Hepatocellular carcinoma ( )
Neoplasm ( )
Neuroblastoma ( )
Parathyroid gland carcinoma ( )
UniProt ID
BIRC6_HUMAN
PDB ID
3CEG; 8ATM; 8ATO; 8ATU; 8ATX; 8AUK; 8AUW; 8E2D; 8E2E; 8E2F; 8E2G; 8E2H; 8E2I; 8E2K
EC Number
2.3.2.27
Pfam ID
PF00653 ; PF12356 ; PF00179
Sequence
MVTGGGAAPPGTVTEPLPSVIVLSAGRKMAAAAAAASGPGCSSAAGAGAAGVSEWLVLRD
GCMHCDADGLHSLSYHPALNAILAVTSRGTIKVIDGTSGATLQASALSAKPGGQVKCQYI
SAVDKVIFVDDYAVGCRKDLNGILLLDTALQTPVSKQDDVVQLELPVTEAQQLLSACLEK
VDISSTEGYDLFITQLKDGLKNTSHETAANHKVAKWATVTFHLPHHVLKSIASAIVNELK
KINQNVAALPVASSVMDRLSYLLPSARPELGVGPGRSVDRSLMYSEANRRETFTSWPHVG
YRWAQPDPMAQAGFYHQPASSGDDRAMCFTCSVCLVCWEPTDEPWSEHERHSPNCPFVKG
EHTQNVPLSVTLATSPAQFPCTDGTDRISCFGSGSCPHFLAAATKRGKICIWDVSKLMKV
HLKFEINAYDPAIVQQLILSGDPSSGVDSRRPTLAWLEDSSSCSDIPKLEGDSDDLLEDS
DSEEHSRSDSVTGHTSQKEAMEVSLDITALSILQQPEKLQWEIVANVLEDTVKDLEELGA
NPCLTNSKSEKTKEKHQEQHNIPFPCLLAGGLLTYKSPATSPISSNSHRSLDGLSRTQGE
SISEQGSTDNESCTNSELNSPLVRRTLPVLLLYSIKESDEKAGKIFSQMNNIMSKSLHDD
GFTVPQIIEMELDSQEQLLLQDPPVTYIQQFADAAANLTSPDSEKWNSVFPKPGTLVQCL
RLPKFAEEENLCIDSITPCADGIHLLVGLRTCPVESLSAINQVEALNNLNKLNSALCNRR
KGELESNLAVVNGANISVIQHESPADVQTPLIIQPEQRNVSGGYLVLYKMNYATRIVTLE
EEPIKIQHIKDPQDTITSLILLPPDILDNREDDCEEPIEDMQLTSKNGFEREKTSDISTL
GHLVITTQGGYVKILDLSNFEILAKVEPPKKEGTEEQDTFVSVIYCSGTDRLCACTKGGE
LHFLQIGGTCDDIDEADILVDGSLSKGIEPSSEGSKPLSNPSSPGISGVDLLVDQPFTLE
ILTSLVELTRFETLTPRFSATVPPCWVEVQQEQQQRRHPQHLHQQHHGDAAQHTRTWKLQ
TDSNSWDEHVFELVLPKACMVGHVDFKFVLNSNITNIPQIQVTLLKNKAPGLGKVNALNI
EVEQNGKPSLVDLNEEMQHMDVEESQCLRLCPFLEDHKEDILCGPVWLASGLDLSGHAGM
LTLTSPKLVKGMAGGKYRSFLIHVKAVNERGTEEICNGGMRPVVRLPSLKHQSNKGYSLA
SLLAKVAAGKEKSSNVKNENTSGTRKSENLRGCDLLQEVSVTIRRFKKTSISKERVQRCA
MLQFSEFHEKLLNTLCRKTDDGQITEHAQSLVLDTLCWLAGVHSNGPGSSKEGNENLLSK
TRKFLSDIVRVCFFEAGRSIAHKCARFLALCISNGKCDPCQPAFGPVLLKALLDNMSFLP
AATTGGSVYWYFVLLNYVKDEDLAGCSTACASLLTAVSRQLQDRLTPMEALLQTRYGLYS
SPFDPVLFDLEMSGSSCKNVYNSSIGVQSDEIDLSDVLSGNGKVSSCTAAEGSFTSLTGL
LEVEPLHFTCVSTSDGTRIERDDAMSSFGVTPAVGGLSSGTVGEASTALSSAAQVALQSL
SHAMASAEQQLQVLQEKQQQLLKLQQQKAKLEAKLHQTTAAAAAAASAVGPVHNSVPSNP
VAAPGFFIHPSDVIPPTPKTTPLFMTPPLTPPNEAVSVVINAELAQLFPGSVIDPPAVNL
AAHNKNSNKSRMNPLGSGLALAISHASHFLQPPPHQSIIIERMHSGARRFVTLDFGRPIL
LTDVLIPTCGDLASLSIDIWTLGEEVDGRRLVVATDISTHSLILHDLIPPPVCRFMKITV
IGRYGSTNARAKIPLGFYYGHTYILPWESELKLMHDPLKGEGESANQPEIDQHLAMMVAL
QEDIQCRYNLACHRLETLLQSIDLPPLNSANNAQYFLRKPDKAVEEDSRVFSAYQDCIQL
QLQLNLAHNAVQRLKVALGASRKMLSETSNPEDLIQTSSTEQLRTIIRYLLDTLLSLLHA
SNGHSVPAVLQSTFHAQACEELFKHLCISGTPKIRLHTGLLLVQLCGGERWWGQFLSNVL
QELYNSEQLLIFPQDRVFMLLSCIGQRSLSNSGVLESLLNLLDNLLSPLQPQLPMHRRTE
GVLDIPMISWVVMLVSRLLDYVATVEDEAAAAKKPLNGNQWSFINNNLHTQSLNRSSKGS
SSLDRLYSRKIRKQLVHHKQQLNLLKAKQKALVEQMEKEKIQSNKGSSYKLLVEQAKLKQ
ATSKHFKDLIRLRRTAEWSRSNLDTEVTTAKESPEIEPLPFTLAHERCISVVQKLVLFLL
SMDFTCHADLLLFVCKVLARIANATRPTIHLCEIVNEPQLERLLLLLVGTDFNRGDISWG
GAWAQYSLTCMLQDILAGELLAPVAAEAMEEGTVGDDVGATAGDSDDSLQQSSVQLLETI
DEPLTHDITGAPPLSSLEKDKEIDLELLQDLMEVDIDPLDIDLEKDPLAAKVFKPISSTW
YDYWGADYGTYNYNPYIGGLGIPVAKPPANTEKNGSQTVSVSVSQALDARLEVGLEQQAE
LMLKMMSTLEADSILQALTNTSPTLSQSPTGTDDSLLGGLQAANQTSQLIIQLSSVPMLN
VCFNKLFSMLQVHHVQLESLLQLWLTLSLNSSSTGNKENGADIFLYNANRIPVISLNQAS
ITSFLTVLAWYPNTLLRTWCLVLHSLTLMTNMQLNSGSSSAIGTQESTAHLLVSDPNLIH
VLVKFLSGTSPHGTNQHSPQVGPTATQAMQEFLTRLQVHLSSTCPQIFSEFLLKLIHILS
TERGAFQTGQGPLDAQVKLLEFTLEQNFEVVSVSTISAVIESVTFLVHHYITCSDKVMSR
SGSDSSVGARACFGGLFANLIRPGDAKAVCGEMTRDQLMFDLLKLVNILVQLPLSGNREY
SARVSVTTNTTDSVSDEEKVSGGKDGNGSSTSVQGSPAYVADLVLANQQIMSQILSALGL
CNSSAMAMIIGASGLHLTKHENFHGGLDAISVGDGLFTILTTLSKKASTVHMMLQPILTY
MACGYMGRQGSLATCQLSEPLLWFILRVLDTSDALKAFHDMGGVQLICNNMVTSTRAIVN
TARSMVSTIMKFLDSGPNKAVDSTLKTRILASEPDNAEGIHNFAPLGTITSSSPTAQPAE
VLLQATPPHRRARSAAWSYIFLPEEAWCDLTIHLPAAVLLKEIHIQPHLASLATCPSSVS
VEVSADGVNMLPLSTPVVTSGLTYIKIQLVKAEVASAVCLRLHRPRDASTLGLSQIKLLG
LTAFGTTSSATVNNPFLPSEDQVSKTSIGWLRLLHHCLTHISDLEGMMASAAAPTANLLQ
TCAALLMSPYCGMHSPNIEVVLVKIGLQSTRIGLKLIDILLRNCAASGSDPTDLNSPLLF
GRLNGLSSDSTIDILYQLGTTQDPGTKDRIQALLKWVSDSARVAAMKRSGRMNYMCPNSS
TVEYGLLMPSPSHLHCVAAILWHSYELLVEYDLPALLDQELFELLFNWSMSLPCNMVLKK
AVDSLLCSMCHVHPNYFSLLMGWMGITPPPVQCHHRLSMTDDSKKQDLSSSLTDDSKNAQ
APLALTESHLATLASSSQSPEAIKQLLDSGLPSLLVRSLASFCFSHISSSESIAQSIDIS
QDKLRRHHVPQQCNKMPITADLVAPILRFLTEVGNSHIMKDWLGGSEVNPLWTALLFLLC
HSGSTSGSHNLGAQQTSARSASLSSAATTGLTTQQRTAIENATVAFFLQCISCHPNNQKL
MAQVLCELFQTSPQRGNLPTSGNISGFIRRLFLQLMLEDEKVTMFLQSPCPLYKGRINAT
SHVIQHPMYGAGHKFRTLHLPVSTTLSDVLDRVSDTPSITAKLISEQKDDKEKKNHEEKE
KVKAENGFQDNYSVVVASGLKSQSKRAVSATPPRPPSRRGRTIPDKIGSTSGAEAANKII
TVPVFHLFHKLLAGQPLPAEMTLAQLLTLLYDRKLPQGYRSIDLTVKLGSRVITDPSLSK
TDSYKRLHPEKDHGDLLASCPEDEALTPGDECMDGILDESLLETCPIQSPLQVFAGMGGL
ALIAERLPMLYPEVIQQVSAPVVTSTTQEKPKDSDQFEWVTIEQSGELVYEAPETVAAEP
PPIKSAVQTMSPIPAHSLAAFGLFLRLPGYAEVLLKERKHAQCLLRLVLGVTDDGEGSHI
LQSPSANVLPTLPFHVLRSLFSTTPLTTDDGVLLRRMALEIGALHLILVCLSALSHHSPR
VPNSSVNQTEPQVSSSHNPTSTEEQQLYWAKGTGFGTGSTASGWDVEQALTKQRLEEEHV
TCLLQVLASYINPVSSAVNGEAQSSHETRGQNSNALPSVLLELLSQSCLIPAMSSYLRND
SVLDMARHVPLYRALLELLRAIASCAAMVPLLLPLSTENGEEEEEQSECQTSVGTLLAKM
KTCVDTYTNRLRSKRENVKTGVKPDASDQEPEGLTLLVPDIQKTAEIVYAATTSLRQANQ
EKKLGEYSKKAAMKPKPLSVLKSLEEKYVAVMKKLQFDTFEMVSEDEDGKLGFKVNYHYM
SQVKNANDANSAARARRLAQEAVTLSTSLPLSSSSSVFVRCDEERLDIMKVLITGPADTP
YANGCFEFDVYFPQDYPSSPPLVNLETTGGHSVRFNPNLYNDGKVCLSILNTWHGRPEEK
WNPQTSSFLQVLVSVQSLILVAEPYFNEPGYERSRGTPSGTQSSREYDGNIRQATVKWAM
LEQIRNPSPCFKEVIHKHFYLKRVEIMAQCEEWIADIQQYSSDKRVGRTMSHHAAALKRH
TAQLREELLKLPCPEGLDPDTDDAPEVCRATTGAEETLMHDQVKPSSSKELPSDFQL
Function
Anti-apoptotic protein which can regulate cell death by controlling caspases and by acting as an E3 ubiquitin-protein ligase. Has an unusual ubiquitin conjugation system in that it could combine in a single polypeptide, ubiquitin conjugating (E2) with ubiquitin ligase (E3) activity, forming a chimeric E2/E3 ubiquitin ligase. Its targets include CASP9 and DIABLO/SMAC. Acts as an inhibitor of CASP3, CASP7 and CASP9. Important regulator for the final stages of cytokinesis. Crucial for normal vesicle targeting to the site of abscission, but also for the integrity of the midbody and the midbody ring, and its striking ubiquitin modification.
Tissue Specificity Expressed in brain cancer cells.
KEGG Pathway
Ubiquitin mediated proteolysis (hsa04120 )
Autophagy - animal (hsa04140 )
Apoptosis - multiple species (hsa04215 )
Reactome Pathway
Signaling by ALK fusions and activated point mutants (R-HSA-9725370 )
ALK mutants bind TKIs (R-HSA-9700645 )

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute myelogenous leukaemia DISCSPTN Definitive Biomarker [1]
Prostate cancer DISF190Y Definitive Altered Expression [2]
Prostate carcinoma DISMJPLE Definitive Altered Expression [2]
Acute leukaemia DISDQFDI Strong Altered Expression [3]
Acute lymphocytic leukaemia DISPX75S Strong Altered Expression [3]
Acute monocytic leukemia DIS28NEL Strong Altered Expression [3]
Advanced cancer DISAT1Z9 Strong Biomarker [4]
B-cell neoplasm DISVY326 Strong Altered Expression [5]
Benign neoplasm DISDUXAD Strong Biomarker [6]
Bone osteosarcoma DIST1004 Strong Altered Expression [7]
Brain cancer DISBKFB7 Strong Altered Expression [8]
Breast cancer DIS7DPX1 Strong Biomarker [9]
Breast carcinoma DIS2UE88 Strong Biomarker [9]
Carcinoma of liver and intrahepatic biliary tract DIS8WA0W Strong Biomarker [10]
Cardiac failure DISDC067 Strong Genetic Variation [11]
Castration-resistant prostate carcinoma DISVGAE6 Strong Altered Expression [12]
Childhood acute lymphoblastic leukemia DISJ5D6U Strong Biomarker [3]
Colon cancer DISVC52G Strong Biomarker [13]
Colon carcinoma DISJYKUO Strong Biomarker [13]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [14]
Congestive heart failure DIS32MEA Strong Genetic Variation [11]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [7]
Esophageal squamous cell carcinoma DIS5N2GV Strong Biomarker [15]
Glaucoma/ocular hypertension DISLBXBY Strong Biomarker [16]
Liver cancer DISDE4BI Strong Biomarker [10]
Lung cancer DISCM4YA Strong Altered Expression [17]
Lung squamous cell carcinoma DISXPIBD Strong Altered Expression [17]
Melanoma DIS1RRCY Strong Genetic Variation [18]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [19]
Osteosarcoma DISLQ7E2 Strong Altered Expression [7]
Ovarian cancer DISZJHAP Strong Biomarker [7]
Ovarian neoplasm DISEAFTY Strong Biomarker [7]
Adult glioblastoma DISVP4LU moderate Biomarker [20]
Glioblastoma multiforme DISK8246 moderate Biomarker [20]
Angle-closure glaucoma DISZ95KY Disputed Genetic Variation [21]
Polycystic kidney disease DISWS3UY Disputed Biomarker [22]
Primary angle-closure glaucoma DISX8UKZ Disputed Genetic Variation [21]
Hepatocellular carcinoma DIS0J828 Limited Biomarker [10]
Neoplasm DISZKGEW Limited Altered Expression [14]
Neuroblastoma DISVZBI4 Limited Biomarker [23]
Parathyroid gland carcinoma DISEER2W Limited Altered Expression [24]
------------------------------------------------------------------------------------
⏷ Show the Full List of 41 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Fluorouracil DMUM7HZ Approved Baculoviral IAP repeat-containing protein 6 (BIRC6) decreases the response to substance of Fluorouracil. [37]
Epirubicin DMPDW6T Approved Baculoviral IAP repeat-containing protein 6 (BIRC6) decreases the response to substance of Epirubicin. [37]
------------------------------------------------------------------------------------
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Baculoviral IAP repeat-containing protein 6 (BIRC6). [25]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Baculoviral IAP repeat-containing protein 6 (BIRC6). [26]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Baculoviral IAP repeat-containing protein 6 (BIRC6). [27]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Baculoviral IAP repeat-containing protein 6 (BIRC6). [28]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Baculoviral IAP repeat-containing protein 6 (BIRC6). [29]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Baculoviral IAP repeat-containing protein 6 (BIRC6). [30]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Baculoviral IAP repeat-containing protein 6 (BIRC6). [31]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the mutagenesis of Baculoviral IAP repeat-containing protein 6 (BIRC6). [32]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Baculoviral IAP repeat-containing protein 6 (BIRC6). [35]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Baculoviral IAP repeat-containing protein 6 (BIRC6). [36]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Baculoviral IAP repeat-containing protein 6 (BIRC6). [33]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Baculoviral IAP repeat-containing protein 6 (BIRC6). [34]
------------------------------------------------------------------------------------

References

1 MicroRNA-204 Potentiates the Sensitivity of Acute Myeloid Leukemia Cells to Arsenic Trioxide.Oncol Res. 2019 Sep 23;27(9):1035-1042. doi: 10.3727/096504019X15528367532612. Epub 2019 Apr 8.
2 The BIRC6 gene as a novel target for therapy of prostate cancer: dual targeting of inhibitors of apoptosis.Oncotarget. 2014 Aug 30;5(16):6896-908. doi: 10.18632/oncotarget.2229.
3 BIRC6/Apollon gene expression in childhood acute leukemia: impact on therapeutic response and prognosis.Eur J Haematol. 2012 Feb;88(2):118-27. doi: 10.1111/j.1600-0609.2011.01734.x. Epub 2012 Jan 4.
4 RNA interference-mediated validation of survivin and Apollon/BRUCE as new therapeutic targets for cancer therapy.Curr Top Med Chem. 2012;12(2):69-78. doi: 10.2174/156802612798919169.
5 circ-BIRC6, a circular RNA, promotes hepatocellular carcinoma progression by targeting the miR-3918/Bcl2 axis.Cell Cycle. 2019 May;18(9):976-989. doi: 10.1080/15384101.2019.1601477. Epub 2019 Apr 16.
6 Oncolytic adenovirus-mediated shRNA against Apollon inhibits tumor cell growth and enhances antitumor effect of 5-fluorouracil.Gene Ther. 2008 Apr;15(7):484-94. doi: 10.1038/gt.2008.6. Epub 2008 Jan 31.
7 Loss of BRUCE reduces cellular energy level and induces autophagy by driving activation of the AMPK-ULK1 autophagic initiating axis.PLoS One. 2019 May 15;14(5):e0216553. doi: 10.1371/journal.pone.0216553. eCollection 2019.
8 A human IAP-family gene, apollon, expressed in human brain cancer cells.Biochem Biophys Res Commun. 1999 Nov 2;264(3):847-54. doi: 10.1006/bbrc.1999.1585.
9 Apollon gene silencing induces apoptosis in breast cancer cells through p53 stabilisation and caspase-3 activation.Br J Cancer. 2009 Mar 10;100(5):739-46. doi: 10.1038/sj.bjc.6604927. Epub 2009 Feb 17.
10 The BRUCE-ATR Signaling Axis Is Required for Accurate DNA Replication and Suppression of Liver Cancer Development.Hepatology. 2019 Jun;69(6):2608-2622. doi: 10.1002/hep.30529. Epub 2019 Mar 13.
11 Patients with HFpEF and HFmrEF have different clinical characteristics in Turkey: A multicenter observational study.Eur J Intern Med. 2019 Mar;61:88-95. doi: 10.1016/j.ejim.2018.11.001. Epub 2018 Nov 13.
12 BIRC6 Targeting as Potential Therapy for Advanced, Enzalutamide-Resistant Prostate Cancer.Clin Cancer Res. 2017 Mar 15;23(6):1542-1551. doi: 10.1158/1078-0432.CCR-16-0718. Epub 2016 Sep 23.
13 Comparative proteomics of colon cancer stem cells and differentiated tumor cells identifies BIRC6 as a potential therapeutic target.Mol Cell Proteomics. 2011 Dec;10(12):M111.011353. doi: 10.1074/mcp.M111.011353. Epub 2011 Jul 25.
14 Overexpression of BIRC6 Is a Predictor of Prognosis for Colorectal Cancer.PLoS One. 2015 May 1;10(5):e0125281. doi: 10.1371/journal.pone.0125281. eCollection 2015.
15 Apollon modulates chemosensitivity in human esophageal squamous cell carcinoma.Oncotarget. 2014 Aug 30;5(16):7183-97. doi: 10.18632/oncotarget.2293.
16 Research progress on human genes involved in the pathogenesis of glaucoma (Review).Mol Med Rep. 2018 Jul;18(1):656-674. doi: 10.3892/mmr.2018.9071. Epub 2018 May 23.
17 Elevated expression of BIRC6 protein in non-small-cell lung cancers is associated with cancer recurrence and chemoresistance.J Thorac Oncol. 2013 Feb;8(2):161-70. doi: 10.1097/JTO.0b013e31827d5237.
18 Role of Apollon in human melanoma resistance to antitumor agents that activate the intrinsic or the extrinsic apoptosis pathways.Clin Cancer Res. 2012 Jun 15;18(12):3316-27. doi: 10.1158/1078-0432.CCR-11-2232. Epub 2012 May 2.
19 Diagnostic investigation of BIRC6 and SIRT1 protein expression level as potential prognostic biomarkers in patients with non-small cell lung cancer.Clin Respir J. 2018 Feb;12(2):633-638. doi: 10.1111/crj.12572. Epub 2016 Nov 20.
20 miR-30e Blocks Autophagy and Acts Synergistically with Proanthocyanidin for Inhibition of AVEN and BIRC6 to Increase Apoptosis in Glioblastoma Stem Cells and Glioblastoma SNB19 Cells.PLoS One. 2016 Jul 7;11(7):e0158537. doi: 10.1371/journal.pone.0158537. eCollection 2016.
21 Association of a polymorphism in the BIRC6 gene with pseudoexfoliative glaucoma.PLoS One. 2014 Aug 13;9(8):e105023. doi: 10.1371/journal.pone.0105023. eCollection 2014.
22 Family-based analysis identified CD2 as a susceptibility gene for primary open angle glaucoma in Chinese Han population.J Cell Mol Med. 2014 Apr;18(4):600-9. doi: 10.1111/jcmm.12201. Epub 2014 Mar 6.
23 Identification of BIRC6 as a novel intervention target for neuroblastoma therapy.BMC Cancer. 2012 Jul 12;12:285. doi: 10.1186/1471-2407-12-285.
24 Molecular profiling of parathyroid hyperplasia, adenoma and carcinoma.Pathol Oncol Res. 2012 Jul;18(3):607-14. doi: 10.1007/s12253-011-9483-7. Epub 2011 Dec 24.
25 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
26 Rapid induction of IAP family proteins and Smac/DIABLO expression after proapoptotic stimulation with doxorubicin in RPMI 8226 multiple myeloma cells. Exp Mol Pathol. 2007 Dec;83(3):405-12. doi: 10.1016/j.yexmp.2007.04.001. Epub 2007 Apr 18.
27 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
28 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
29 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
30 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
31 Effect of zoledronic acid on oral fibroblasts and epithelial cells: a potential mechanism of bisphosphonate-associated osteonecrosis. Br J Haematol. 2009 Mar;144(5):667-76. doi: 10.1111/j.1365-2141.2008.07504.x. Epub 2008 Nov 20.
32 Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
33 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
34 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
35 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
36 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
37 [Knock-down of apollon gene by antisense oligodeoxynucleotide inhibits the proliferation of Lovo cells and enhances chemo-sensitivity]. Yao Xue Xue Bao. 2011 Feb;46(2):138-45.