Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEO98CR)

• DOT Name: Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2)
• Synonyms: eIF-4-gamma 2; eIF-4G 2; eIF4G 2; Death-associated protein 5; DAP-5; p97
• Gene Name: EIF4G2
• Related Disease:
  Malaria
  Adult lymphoma
  Adult T-cell leukemia/lymphoma
  Alzheimer disease
  Alzheimer disease 3
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Carcinoma
  Cervical cancer
  Cervical carcinoma
  Cervical Intraepithelial neoplasia
  Frontotemporal dementia
  Hepatitis B virus infection
  Inclusion body myopathy with Paget disease of bone and frontotemporal dementia
  Lung adenocarcinoma
  Lymphoma
  Mantle cell lymphoma
  Myeloid leukaemia
  Pediatric lymphoma
  Pick disease
  Plasma cell myeloma
  Premature aging syndrome
  Promyelocytic leukaemia
  Squamous cell carcinoma
  Transitional cell carcinoma
  Urinary bladder cancer
  Urinary bladder neoplasm
  Zika virus infection
  Amyotrophic lateral sclerosis
  Dementia
  Herpes simplex infection
  Influenza
  Neuroblastoma
  Adult glioblastoma
  Glioblastoma multiforme
  Ankylosing spondylitis
  Bone Paget disease
  Cutaneous squamous cell carcinoma
  Enterovirus infection
  High blood pressure
  Lung cancer
  Lung carcinoma
  Melanoma
  Myopathy
  Nervous system disease
  Spinocerebellar ataxia type 3
• UniProt ID: IF4G2_HUMAN
• PDB ID: 3D3M; 3L6A; 4IUL
• Pfam ID: PF02847 ; PF02854 ; PF02020
• Sequence:
  MESAIAEGGASRFSASSGGGGSRGAPQHYPKTAGNSEFLGKTPGQNAQKWIPARSTRRDD
  NSAANNSANEKERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVD
  KALEEPKYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTR
  NVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKK
  RVQLKDMGEDLECLCQIMRTVGPRLDHERAKSLMDQYFARMCSLMLSKELPARIRFLLQD
  TVELREHHWVPRKAFLDNGPKTINQIRQDAVKDLGVFIPAPMAQGMRSDFFLEGPFMPPR
  MKMDRDPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPPTQS
  QFGEMGGKFMKSQGLSQLYHNQSQGLLSQLQGQSKDMPPRFSKKGQLNADEISLRPAQSF
  LMNKNQVPKLQPQITMIPPSAQPPRTQTPPLGQTPQLGLKTNPPLIQEKPAKTSKKPPPS
  KEELLKLTETVVTEYLNSGNANEAVNGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKA
  SSLISLLKQEGIATSDNFMQAFLNVLDQCPKLEVDIPLVKSYLAQFAARAIISELVSISE
  LAQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVNMQKMLPEIDQNKDRMLEILE
  GKGLSFLFPLLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYI
  SSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYN
  SNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETAEEE
  ESEEEAD
• Function: Appears to play a role in the switch from cap-dependent to IRES-mediated translation during mitosis, apoptosis and viral infection. Cleaved by some caspases and viral proteases.
• Tissue Specificity: Ubiquitously expressed in all adult tissues examined, with high levels in skeletal muscle and heart. Also expressed in fetal brain, lung, liver and kidney.
• KEGG Pathway: Viral myocarditis (hsa05416)
• Reactome Pathway: ISG15 antiviral mechanism (R-HSA-1169408)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Malaria	DISQ9Y50	Definitive	Biomarker	[1]
Adult lymphoma	DISK8IZR	Strong	Altered Expression	[2]
Adult T-cell leukemia/lymphoma	DIS882XU	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[4]
Alzheimer disease 3	DISVT69G	Strong	Altered Expression	[4]
Bladder cancer	DISUHNM0	Strong	Genetic Variation	[5]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[6]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[6]
Carcinoma	DISH9F1N	Strong	Biomarker	[7]
Cervical cancer	DISFSHPF	Strong	Biomarker	[8]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[8]
Cervical Intraepithelial neoplasia	DISXP757	Strong	Posttranslational Modification	[9]
Frontotemporal dementia	DISKYHXL	Strong	Genetic Variation	[10]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[11]
Inclusion body myopathy with Paget disease of bone and frontotemporal dementia	DISK4S94	Strong	Genetic Variation	[12]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[13]
Lymphoma	DISN6V4S	Strong	Altered Expression	[2]
Mantle cell lymphoma	DISFREOV	Strong	Biomarker	[14]
Myeloid leukaemia	DISMN944	Strong	Biomarker	[15]
Pediatric lymphoma	DIS51BK2	Strong	Altered Expression	[2]
Pick disease	DISP6X50	Strong	Genetic Variation	[10]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[16]
Premature aging syndrome	DIS51AGT	Strong	Biomarker	[17]
Promyelocytic leukaemia	DISYGG13	Strong	Biomarker	[18]
Squamous cell carcinoma	DISQVIFL	Strong	Posttranslational Modification	[9]
Transitional cell carcinoma	DISWVVDR	Strong	Altered Expression	[19]
Urinary bladder cancer	DISDV4T7	Strong	Genetic Variation	[5]
Urinary bladder neoplasm	DIS7HACE	Strong	Genetic Variation	[5]
Zika virus infection	DISQUCTY	Strong	Biomarker	[20]
Amyotrophic lateral sclerosis	DISF7HVM	moderate	Genetic Variation	[21]
Dementia	DISXL1WY	moderate	Biomarker	[22]
Herpes simplex infection	DISL1SAV	moderate	Altered Expression	[23]
Influenza	DIS3PNU3	moderate	Altered Expression	[23]
Neuroblastoma	DISVZBI4	moderate	Biomarker	[24]
Adult glioblastoma	DISVP4LU	Disputed	Altered Expression	[25]
Glioblastoma multiforme	DISK8246	Disputed	Biomarker	[25]
Ankylosing spondylitis	DISRC6IR	Limited	Genetic Variation	[26]
Bone Paget disease	DISIPS4V	Limited	Genetic Variation	[27]
Cutaneous squamous cell carcinoma	DIS3LXUG	Limited	Altered Expression	[28]
Enterovirus infection	DISH2UDP	Limited	Biomarker	[29]
High blood pressure	DISY2OHH	Limited	Biomarker	[30]
Lung cancer	DISCM4YA	Limited	Biomarker	[31]
Lung carcinoma	DISTR26C	Limited	Biomarker	[31]
Melanoma	DIS1RRCY	Limited	Biomarker	[32]
Myopathy	DISOWG27	Limited	Genetic Variation	[10]
Nervous system disease	DISJ7GGT	Limited	Genetic Variation	[33]
Spinocerebellar ataxia type 3	DISQBQID	Limited	Biomarker	[34]

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[35]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[18]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[37]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[38]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[39]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[40]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[18]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[41]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[42]
Menthol	DMG2KW7	Approved	Menthol decreases the expression of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[43]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[44]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[45]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[18]
LY294002	DMY1AFS	Phase 1	LY294002 increases the expression of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[18]
Scriptaid	DM9JZ21	Preclinical	Scriptaid affects the expression of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[46]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[47]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[45]
Rapamycin Immunosuppressant Drug	DM678IB	Investigative	Rapamycin Immunosuppressant Drug increases the expression of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[18]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the cleavage of Eukaryotic translation initiation factor 4 gamma 2 (EIF4G2).	[18]

References

• [1] Distinct effects of HIV protease inhibitors and ERAD inhibitors on zygote to ookinete transition of the malaria parasite.Mol Biochem Parasitol. 2018 Mar;220:10-14. doi: 10.1016/j.molbiopara.2017.12.003. Epub 2018 Jan 3.
• [2] The Transitional Endoplasmic Reticulum ATPase p97 Regulates the Alternative Nuclear Factor NF-B Signaling via Partial Degradation of the NF-B Subunit p100.J Biol Chem. 2015 Aug 7;290(32):19558-68. doi: 10.1074/jbc.M114.630061. Epub 2015 Jun 25.
• [3] p53 stabilization and functional impairment in the absence of genetic mutation or the alteration of the p14(ARF)-MDM2 loop in ex vivo and cultured adult T-cell leukemia/lymphoma cells.Blood. 2000 Jun 15;95(12):3939-44.
• [4] Melanotransferrin is produced by senile plaque-associated reactive microglia in Alzheimer's disease.Brain Res. 1999 Oct 16;845(1):1-5. doi: 10.1016/s0006-8993(99)01767-9.
• [5] Genetic polymorphisms of N-acetyltransferase 1 and 2 and risk of cigarette smoking-related bladder cancer.Br J Cancer. 1999 Oct;81(3):537-41. doi: 10.1038/sj.bjc.6690727.
• [6] Arylamine N-acetyltransferase-1 is highly expressed in breast cancers and conveys enhanced growth and resistance to etoposide in vitro.Mol Cancer Res. 2003 Sep;1(11):826-35.
• [7] Comparison of recombinant and synthetically formed monoclonal antibody-beta-lactamase conjugates for anticancer prodrug activation.Bioconjug Chem. 1999 Nov-Dec;10(6):1084-9. doi: 10.1021/bc990075w.
• [8] circEIF4G2 modulates the malignant features of cervical cancer via the miR?18/HOXA1 pathway.Mol Med Rep. 2019 May;19(5):3714-3722. doi: 10.3892/mmr.2019.10032. Epub 2019 Mar 14.
• [9] Human papillomavirus types 16 E1 mRNA is transcribed from P14 early promoter in cervical neoplasms.Virology. 2016 Jan 15;488:196-201. doi: 10.1016/j.virol.2015.11.015. Epub 2015 Dec 2.
• [10] A conserved inter-domain communication mechanism regulates the ATPase activity of the AAA-protein Drg1.Sci Rep. 2017 Mar 17;7:44751. doi: 10.1038/srep44751.
• [11] Efficacy of hepatitis B virus (HBV) DNA screening and characterization of acute and occult HBV infections among blood donors from Madrid, Spain.Transfusion. 2010 Jan;50(1):221-30. doi: 10.1111/j.1537-2995.2009.02343.x. Epub 2009 Aug 4.
• [12] ZFAND1 Recruits p97 and the 26S Proteasome to Promote the Clearance of Arsenite-Induced Stress Granules.Mol Cell. 2018 Jun 7;70(5):906-919.e7. doi: 10.1016/j.molcel.2018.04.021. Epub 2018 May 24.
• [13] Tobacco smoke activates human papillomavirus 16 p97 promoter and cooperates with high-risk E6/E7 for oxidative DNA damage in lung cells.PLoS One. 2015 Apr 1;10(4):e0123029. doi: 10.1371/journal.pone.0123029. eCollection 2015.
• [14] Functional cooperativity of p97 and histone deacetylase 6 in mediating DNA repair in mantle cell lymphoma cells.Leukemia. 2019 Jul;33(7):1675-1686. doi: 10.1038/s41375-018-0355-y. Epub 2019 Jan 21.
• [15] miR-139-5p controls translation in myeloid leukemia through EIF4G2.Oncogene. 2016 Apr 7;35(14):1822-31. doi: 10.1038/onc.2015.247. Epub 2015 Jul 13.
• [16] Novel cell line models to study mechanisms and overcoming strategies of proteasome inhibitor resistance in multiple myeloma.Biochim Biophys Acta Mol Basis Dis. 2019 Jun 1;1865(6):1666-1676. doi: 10.1016/j.bbadis.2019.04.003. Epub 2019 Apr 4.
• [17] The Interplay of Cofactor Interactions and Post-translational Modifications in the Regulation of the AAA+ ATPase p97.Front Mol Biosci. 2017 Apr 13;4:21. doi: 10.3389/fmolb.2017.00021. eCollection 2017.
• [18] Death-associated protein 5 (DAP5/p97/NAT1) contributes to retinoic acid-induced granulocytic differentiation and arsenic trioxide-induced apoptosis in acute promyelocytic leukemia. Apoptosis. 2008 Jul;13(7):915-28. doi: 10.1007/s10495-008-0222-9.
• [19] The transcripts of SFRP1,CEP63 and EIF4G2 genes are frequently downregulated in transitional cell carcinomas of the bladder.Oncology. 2005;69(6):445-54. doi: 10.1159/000090984. Epub 2006 Jan 12.
• [20] Vero Cell Proteomic Changes Induced by Zika Virus Infection.Proteomics. 2019 Feb;19(4):e1800309. doi: 10.1002/pmic.201800309. Epub 2019 Jan 23.
• [21] VAPB/ALS8 interacts with FFAT-like proteins including the p97 cofactor FAF1 and the ASNA1 ATPase.BMC Biol. 2014 May 29;12:39. doi: 10.1186/1741-7007-12-39.
• [22] Late-onset autosomal dominant limb girdle muscular dystrophy and Paget's disease of bone unlinked to the VCP gene locus.J Neurol Sci. 2010 Apr 15;291(1-2):79-85. doi: 10.1016/j.jns.2009.12.008. Epub 2010 Feb 8.
• [23] p97: An Emerging Target for Cancer, Neurodegenerative Diseases, and Viral Infections.J Med Chem. 2020 Mar 12;63(5):1892-1907. doi: 10.1021/acs.jmedchem.9b01318. Epub 2019 Oct 9.
• [24] DAP-5 is involved in MycN/IFNgamma-induced apoptosis in human neuroblastoma cells.Cancer Lett. 2001 Jan 26;162(2):237-43. doi: 10.1016/s0304-3835(00)00644-3.
• [25] LINC01579 promotes cell proliferation by acting as a ceRNA of miR-139-5p to upregulate EIF4G2 expression in glioblastoma.J Cell Physiol. 2019 Dec;234(12):23658-23666. doi: 10.1002/jcp.28933. Epub 2019 Jun 11.
• [26] Position 97 of HLA-B, a residue implicated in pathogenesis of ankylosing spondylitis, plays a key role in cell surface free heavy chain expression.Ann Rheum Dis. 2017 Mar;76(3):593-601. doi: 10.1136/annrheumdis-2016-209512. Epub 2016 Aug 11.
• [27] VCP/p97 increases BMP signaling by accelerating ubiquitin ligase Smurf1 degradation.FASEB J. 2019 Feb;33(2):2928-2943. doi: 10.1096/fj.201801173R. Epub 2018 Oct 18.
• [28] The Identification of Potential TherapeuticTargets for Cutaneous SquamousCell Carcinoma.J Invest Dermatol. 2020 Jun;140(6):1154-1165.e5. doi: 10.1016/j.jid.2019.09.024. Epub 2019 Nov 6.
• [29] Enterovirus 71 protease 2Apro and 3Cpro differentially inhibit the cellular endoplasmic reticulum-associated degradation (ERAD) pathway via distinct mechanisms, and enterovirus 71 hijacks ERAD component p97 to promote its replication.PLoS Pathog. 2017 Oct 6;13(10):e1006674. doi: 10.1371/journal.ppat.1006674. eCollection 2017 Oct.
• [30] Expression of the translational repressor NAT1 in experimental models of cardiac hypertrophy.Mol Cell Biochem. 2003 Mar;245(1-2):183-90. doi: 10.1023/a:1022884515544.
• [31] Suppression of EIF4G2 by miR-379 potentiates the cisplatin chemosensitivity in nonsmall cell lung cancer cells.FEBS Lett. 2017 Feb;591(4):636-645. doi: 10.1002/1873-3468.12566. Epub 2017 Feb 20.
• [32] Discrepancy Between Tumor Antigen Distribution and Radiolabeled Antibody Binding in a Nude Mouse Xenograft Model of Human Melanoma.Cancer Biother Radiopharm. 2017 Apr;32(3):83-89. doi: 10.1089/cbr.2016.2115. Epub 2017 Apr 5.
• [33] Crystal structure of the catalytic D2 domain of the AAA+ ATPase p97 reveals a putative helical split-washer-type mechanism for substrate unfolding.FEBS Lett. 2020 Mar;594(5):933-943. doi: 10.1002/1873-3468.13667. Epub 2019 Nov 22.
• [34] Imbalances in p97 co-factor interactions in human proteinopathy.EMBO Rep. 2010 Jun;11(6):479-85. doi: 10.1038/embor.2010.49. Epub 2010 Apr 23.
• [35] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [36] Death-associated protein 5 (DAP5/p97/NAT1) contributes to retinoic acid-induced granulocytic differentiation and arsenic trioxide-induced apoptosis in acute promyelocytic leukemia. Apoptosis. 2008 Jul;13(7):915-28. doi: 10.1007/s10495-008-0222-9.
• [37] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [38] Mechanism of cisplatin proximal tubule toxicity revealed by integrating transcriptomics, proteomics, metabolomics and biokinetics. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):117-27.
• [39] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [40] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [41] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [42] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [43] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [44] Molecular mechanisms of resveratrol action in lung cancer cells using dual protein and microarray analyses. Cancer Res. 2007 Dec 15;67(24):12007-17. doi: 10.1158/0008-5472.CAN-07-2464.
• [45] Gene expression-signature of belinostat in cell lines is specific for histone deacetylase inhibitor treatment, with a corresponding signature in xenografts. Anticancer Drugs. 2009 Sep;20(8):682-92.
• [46] Histone deacetylase inhibitor scriptaid induces cell cycle arrest and epigenetic change in colon cancer cells. Int J Oncol. 2008 Oct;33(4):767-76.
• [47] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.