Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTH0CRCZ)

• DOT Name: Protein sprouty homolog 2 (SPRY2)
• Synonyms: Spry-2
• Gene Name: SPRY2
• Related Disease:
  Glioma
  Liver cirrhosis
  Lymphoma
  Non-small-cell lung cancer
  Achalasia
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Cardiovascular disease
  Cervical cancer
  Cervical carcinoma
  Clear cell renal carcinoma
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Epithelial ovarian cancer
  Hepatocellular carcinoma
  IgA nephropathy
  Isolated cleft lip
  Isolated cleft palate
  Liver cancer
  Lung cancer
  Lung neoplasm
  Matthew-Wood syndrome
  Melanoma
  Non-insulin dependent diabetes
  Osteoarthritis
  Osteosarcoma
  Plasma cell myeloma
  Prostate carcinoma
  Prostate neoplasm
  Renal cell carcinoma
  Rheumatoid arthritis
  Carcinoma
  Gastric cancer
  Metastatic malignant neoplasm
  Neuroblastoma
  Stomach cancer
  Advanced cancer
  Glioblastoma multiforme
  IgA nephropathy, susceptibility to, 3
  Prostate cancer
  Pulmonary disease
  Squamous cell carcinoma
  Tourette syndrome
• UniProt ID: SPY2_HUMAN
• PDB ID: 3BUM; 3OB1; 5HKY; 5HKZ; 5HL0
• Pfam ID: PF05210
• Sequence:
  MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPT
  VVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRLQHSQVHSSARAPLSRSISTVSSGSRS
  STRTSTSSSSSEQRLLGSSFSSGPVADGIIRVQPKSELKPGELKPLSKEDLGLHAYRCED
  CGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVCCVKGLFYHCSNDDEDNCADN
  PCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVC
  CKVPTVPPRNFEKPT
• Function: Antagonist of fibroblast growth factor (FGF) pathways via inhibition of FGF-mediated phosphorylation of ERK1/2. Thereby acts as an antagonist of FGF-induced retinal lens fiber differentiation, may inhibit limb bud outgrowth and may negatively modulate respiratory organogenesis. Inhibits TGFB-induced epithelial-to-mesenchymal transition in retinal lens epithelial cells. Inhibits CBL/C-CBL-mediated EGFR ubiquitination.
• KEGG Pathway: MicroR.s in cancer (hsa05206)
• Reactome Pathway:
  EGFR downregulation (R-HSA-182971)
  Spry regulation of FGF signaling (R-HSA-1295596)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Glioma	DIS5RPEH	Definitive	Biomarker	[1]
Liver cirrhosis	DIS4G1GX	Definitive	Biomarker	[2]
Lymphoma	DISN6V4S	Definitive	Posttranslational Modification	[3]
Non-small-cell lung cancer	DIS5Y6R9	Definitive	Biomarker	[4]
Achalasia	DISK845N	Strong	Biomarker	[5]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[8]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Posttranslational Modification	[9]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[10]
Cervical cancer	DISFSHPF	Strong	Genetic Variation	[11]
Cervical carcinoma	DIST4S00	Strong	Genetic Variation	[11]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[12]
Colon cancer	DISVC52G	Strong	Biomarker	[13]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[13]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[14]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[16]
IgA nephropathy	DISZ8MTK	Strong	Altered Expression	[17]
Isolated cleft lip	DIS2O2JV	Strong	Biomarker	[18]
Isolated cleft palate	DISV80CD	Strong	Biomarker	[18]
Liver cancer	DISDE4BI	Strong	Posttranslational Modification	[9]
Lung cancer	DISCM4YA	Strong	Biomarker	[19]
Lung neoplasm	DISVARNB	Strong	Biomarker	[19]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[20]
Melanoma	DIS1RRCY	Strong	Altered Expression	[21]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[22]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[23]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[6]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[24]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[25]
Prostate neoplasm	DISHDKGQ	Strong	Posttranslational Modification	[26]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[12]
Rheumatoid arthritis	DISTSB4J	Strong	Altered Expression	[27]
Carcinoma	DISH9F1N	moderate	Altered Expression	[28]
Gastric cancer	DISXGOUK	moderate	Biomarker	[29]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[30]
Neuroblastoma	DISVZBI4	moderate	Biomarker	[31]
Stomach cancer	DISKIJSX	moderate	Biomarker	[29]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[25]
Glioblastoma multiforme	DISK8246	Limited	Biomarker	[32]
IgA nephropathy, susceptibility to, 3	DISF51DA	Limited	Autosomal dominant	[33]
Prostate cancer	DISF190Y	Limited	Biomarker	[25]
Pulmonary disease	DIS6060I	Limited	Biomarker	[34]
Squamous cell carcinoma	DISQVIFL	Limited	Altered Expression	[35]
Tourette syndrome	DISX9D54	Limited	Unknown	[36]

29 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein sprouty homolog 2 (SPRY2).	[37]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Protein sprouty homolog 2 (SPRY2).	[38]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein sprouty homolog 2 (SPRY2).	[39]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Protein sprouty homolog 2 (SPRY2).	[40]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Protein sprouty homolog 2 (SPRY2).	[41]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Protein sprouty homolog 2 (SPRY2).	[42]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Protein sprouty homolog 2 (SPRY2).	[44]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Protein sprouty homolog 2 (SPRY2).	[45]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Protein sprouty homolog 2 (SPRY2).	[46]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Protein sprouty homolog 2 (SPRY2).	[47]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Protein sprouty homolog 2 (SPRY2).	[48]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Protein sprouty homolog 2 (SPRY2).	[49]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Protein sprouty homolog 2 (SPRY2).	[51]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Protein sprouty homolog 2 (SPRY2).	[52]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of Protein sprouty homolog 2 (SPRY2).	[53]
Crocin	DM5F24X	Phase 3	Crocin increases the expression of Protein sprouty homolog 2 (SPRY2).	[54]
PD-0325901	DM27D4J	Phase 2	PD-0325901 decreases the expression of Protein sprouty homolog 2 (SPRY2).	[55]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Protein sprouty homolog 2 (SPRY2).	[56]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Protein sprouty homolog 2 (SPRY2).	[57]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Protein sprouty homolog 2 (SPRY2).	[58]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Protein sprouty homolog 2 (SPRY2).	[59]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Protein sprouty homolog 2 (SPRY2).	[60]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Protein sprouty homolog 2 (SPRY2).	[61]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Protein sprouty homolog 2 (SPRY2).	[62]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Protein sprouty homolog 2 (SPRY2).	[63]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride decreases the expression of Protein sprouty homolog 2 (SPRY2).	[64]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine decreases the expression of Protein sprouty homolog 2 (SPRY2).	[65]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of Protein sprouty homolog 2 (SPRY2).	[45]
Taurine	DMVW7N3	Investigative	Taurine increases the expression of Protein sprouty homolog 2 (SPRY2).	[66]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Protein sprouty homolog 2 (SPRY2).	[43]
Fulvestrant	DM0YZC6	Approved	Fulvestrant affects the methylation of Protein sprouty homolog 2 (SPRY2).	[50]

References

• [1] MiR-21 enhanced glioma cells resistance to carmustine via decreasing Spry2 expression.Eur Rev Med Pharmacol Sci. 2017 Nov;21(22):5065-5071. doi: 10.26355/eurrev_201711_13819.
• [2] MiR-21 simultaneously regulates ERK1 signaling in HSC activation and hepatocyte EMT in hepatic fibrosis.PLoS One. 2014 Oct 10;9(10):e108005. doi: 10.1371/journal.pone.0108005. eCollection 2014.
• [3] Expression of sprouty2 inhibits B-cell proliferation and is epigenetically silenced in mouse and human B-cell lymphomas.Blood. 2009 Mar 12;113(11):2478-87. doi: 10.1182/blood-2008-05-156943. Epub 2009 Jan 15.
• [4] Down-regulation of Sprouty2 in non-small cell lung cancer contributes to tumor malignancy via extracellular signal-regulated kinase pathway-dependent and -independent mechanisms.Mol Cancer Res. 2007 May;5(5):509-20. doi: 10.1158/1541-7786.MCR-06-0273.
• [5] Loss of mammalian Sprouty2 leads to enteric neuronal hyperplasia and esophageal achalasia.Nat Neurosci. 2005 Jul;8(7):855-7. doi: 10.1038/nn1485.
• [6] MicroRNA-330-5p promotes the development of osteosarcoma by regulating SPRY2.Eur Rev Med Pharmacol Sci. 2019 Oct;23(20):8761-8770. doi: 10.26355/eurrev_201910_19270.
• [7] The ras/mitogen-activated protein kinase pathway inhibitor and likely tumor suppressor proteins, sprouty 1 and sprouty 2 are deregulated in breast cancer.Cancer Res. 2004 Sep 1;64(17):6127-36. doi: 10.1158/0008-5472.CAN-04-1207.
• [8] Sprouty 2 is an independent prognostic factor in breast cancer and may be useful in stratifying patients for trastuzumab therapy.PLoS One. 2011;6(8):e23772. doi: 10.1371/journal.pone.0023772. Epub 2011 Aug 31.
• [9] Inactivation of Spry2 accelerates AKT-driven hepatocarcinogenesis via activation of MAPK and PKM2 pathways.J Hepatol. 2012 Sep;57(3):577-83. doi: 10.1016/j.jhep.2012.04.026. Epub 2012 May 19.
• [10] MicroRNA-21 in cardiovascular disease.J Cardiovasc Transl Res. 2010 Jun;3(3):251-5. doi: 10.1007/s12265-010-9169-7. Epub 2010 May 1.
• [11] Single nucleotide polymorphisms in microRNA genes are associated with cervical cancer susceptibility in a population from Xinjiang Uygur.Oncotarget. 2016 Nov 1;7(44):71447-71454. doi: 10.18632/oncotarget.12212.
• [12] Sprouty2 is associated with prognosis and suppresses cell proliferation and invasion in renal cell carcinoma.Urology. 2013 Jul;82(1):253.e1-7. doi: 10.1016/j.urology.2013.02.051. Epub 2013 May 17.
• [13] SPROUTY-2 represses the epithelial phenotype of colon carcinoma cells via upregulation of ZEB1 mediated by ETS1 and miR-200/miR-150.Oncogene. 2016 Jun 9;35(23):2991-3003. doi: 10.1038/onc.2015.366. Epub 2015 Oct 12.
• [14] Atypical role of sprouty in colorectal cancer: sprouty repression inhibits epithelial-mesenchymal transition.Oncogene. 2016 Jun 16;35(24):3151-62. doi: 10.1038/onc.2015.365. Epub 2015 Oct 5.
• [15] Loss of Sprouty2 in human high-grade serous ovarian carcinomas promotes EGF-induced E-cadherin down-regulation and cell invasion.FEBS Lett. 2015 Jan 30;589(3):302-9. doi: 10.1016/j.febslet.2014.12.012. Epub 2014 Dec 20.
• [16] miR-330-5p targets SPRY2 to promote hepatocellular carcinoma progression via MAPK/ERK signaling.Oncogenesis. 2018 Nov 21;7(11):90. doi: 10.1038/s41389-018-0097-8.
• [17] A SPRY2 mutation leading to MAPK/ERK pathway inhibition is associated with an autosomal dominant form of IgA nephropathy. Eur J Hum Genet. 2015 Dec;23(12):1673-8. doi: 10.1038/ejhg.2015.52. Epub 2015 Mar 18.
• [18] Stage-dependent craniofacial defects resulting from Sprouty2 overexpression.Dev Dyn. 2007 Jul;236(7):1918-28. doi: 10.1002/dvdy.21195.
• [19] Sprouty 2 gene in mouse lung tumorigenesis.Chest. 2004 May;125(5 Suppl):111S. doi: 10.1378/chest.125.5_suppl.111s.
• [20] Knockdown of FOXO3a induces epithelial-mesenchymal transition and promotes metastasis of pancreatic ductal adenocarcinoma by activation of the -catenin/TCF4 pathway through SPRY2.J Exp Clin Cancer Res. 2019 Jan 28;38(1):38. doi: 10.1186/s13046-019-1046-x.
• [21] SPRY2 is an inhibitor of the ras/extracellular signal-regulated kinase pathway in melanocytes and melanoma cells with wild-type BRAF but not with the V599E mutant.Cancer Res. 2004 Aug 15;64(16):5556-9. doi: 10.1158/0008-5472.CAN-04-1669.
• [22] CRISPR-Cas9-mediated knockout of SPRY2 in human hepatocytes leads to increased glucose uptake and lipid droplet accumulation.BMC Endocr Disord. 2019 Oct 29;19(1):115. doi: 10.1186/s12902-019-0442-8.
• [23] Intraarticular gene transfer of SPRY2 suppresses adjuvant-induced arthritis in rats.Appl Microbiol Biotechnol. 2015 Aug;99(16):6727-35. doi: 10.1007/s00253-015-6618-x. Epub 2015 May 3.
• [24] Increased expression of miR-27 predicts poor prognosis and promotes tumorigenesis in human multiple myeloma.Biosci Rep. 2019 Apr 9;39(4):BSR20182502. doi: 10.1042/BSR20182502. Print 2019 Apr 30.
• [25] Long non-coding RNA CASC2 regulates Sprouty2 via functioning as a competing endogenous RNA for miR-183 to modulate the sensitivity of prostate cancer cells to docetaxel.Arch Biochem Biophys. 2019 Apr 15;665:69-78. doi: 10.1016/j.abb.2018.01.013. Epub 2018 Jan 31.
• [26] Concomitant down-regulation of SPRY1 and SPRY2 in prostate carcinoma.Endocr Relat Cancer. 2006 Sep;13(3):839-49. doi: 10.1677/erc.1.01190.
• [27] Dyrk1A promotes the proliferation, migration and invasion of fibroblast-like synoviocytes in rheumatoid arthritis via down-regulating Spry2 and activating the ERK MAPK pathway.Tissue Cell. 2018 Dec;55:63-70. doi: 10.1016/j.tice.2018.10.002. Epub 2018 Oct 28.
• [28] SPROUTY2 is a -catenin and FOXO3a target gene indicative of poor prognosis in colon cancer.Oncogene. 2014 Apr 10;33(15):1975-85. doi: 10.1038/onc.2013.140. Epub 2013 Apr 29.
• [29] MiR-592 Promotes Gastric Cancer Proliferation, Migration, and Invasion Through the PI3K/AKT and MAPK/ERK Signaling Pathways by Targeting Spry2.Cell Physiol Biochem. 2018;47(4):1465-1481. doi: 10.1159/000490839. Epub 2018 Jun 21.
• [30] Downregulation of Sprouty homolog2 by microRNA-21 inhibits proliferation, metastasis and invasion, however promotes the apoptosis of multiple myeloma cells.Mol Med Rep. 2015 Aug;12(2):1810-6. doi: 10.3892/mmr.2015.3567. Epub 2015 Mar 30.
• [31] Sprouty2 regulates growth and differentiation of human neuroblastoma cells through RET tyrosine kinase.Cancer Sci. 2007 Jun;98(6):815-21. doi: 10.1111/j.1349-7006.2007.00457.x. Epub 2007 Mar 27.
• [32] Sprouty2 enhances the tumorigenic potential of glioblastoma cells.Neuro Oncol. 2018 Jul 5;20(8):1044-1054. doi: 10.1093/neuonc/noy028.
• [33] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [34] Spatiotemporal alterations in Sprouty-2 expression and tyrosine phosphorylation in nitrofen-induced pulmonary hypoplasia.J Pediatr Surg. 2013 Nov;48(11):2219-25. doi: 10.1016/j.jpedsurg.2013.07.003.
• [35] Overexpression of sprouty2 in human oral squamous cell carcinogenesis.Arch Oral Biol. 2018 Mar;87:131-142. doi: 10.1016/j.archoralbio.2017.12.021. Epub 2017 Dec 27.
• [36] De Novo Coding Variants Are Strongly Associated with Tourette Disorder. Neuron. 2017 May 3;94(3):486-499.e9. doi: 10.1016/j.neuron.2017.04.024.
• [37] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [38] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [39] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [40] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [41] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [42] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [43] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [44] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [45] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [46] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [47] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [48] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [49] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [50] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [51] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [52] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [53] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [54] Crocin suppresses breast cancer cell proliferation by down-regulating tumor promoter miR-122-5p and up-regulating tumor suppressors FOXP2 and SPRY2. Environ Toxicol. 2023 Jul;38(7):1597-1608. doi: 10.1002/tox.23789. Epub 2023 Mar 29.
• [55] PRC2 loss amplifies Ras-driven transcription and confers sensitivity to BRD4-based therapies. Nature. 2014 Oct 9;514(7521):247-51.
• [56] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [57] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [58] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [59] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [60] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [61] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [62] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [63] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [64] Nickel may contribute to EGFR mutation and synergistically promotes tumor invasion in EGFR-mutated lung cancer via nickel-induced microRNA-21 expression. Toxicol Lett. 2015 Aug 19;237(1):46-54. doi: 10.1016/j.toxlet.2015.05.019. Epub 2015 May 27.
• [65] Microarray Analysis of Gene Expression Alteration in Human Middle Ear Epithelial Cells Induced by Asian Sand Dust. Clin Exp Otorhinolaryngol. 2015 Dec;8(4):345-53. doi: 10.3342/ceo.2015.8.4.345. Epub 2015 Nov 10.
• [66] Taurine-responsive genes related to signal transduction as identified by cDNA microarray analyses of HepG2 cells. J Med Food. 2006 Spring;9(1):33-41. doi: 10.1089/jmf.2006.9.33.