Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIRJXWM)

• DOT Name: AT-rich interactive domain-containing protein 2 (ARID2)
• Synonyms: ARID domain-containing protein 2; BRG1-associated factor 200; BAF200; Zinc finger protein with activation potential; Zipzap/p200
• Gene Name: ARID2
• Related Disease:
  Coffin-Siris syndrome
  Diabetic kidney disease
  Nephropathy
  Non-insulin dependent diabetes
  Type-1/2 diabetes
  Xeroderma pigmentosum group G
  Atrioventricular block
  Autism spectrum disorder
  Carcinoma of liver and intrahepatic biliary tract
  Coffin-Siris syndrome 6
  Familial adenomatous polyposis
  Gastric cancer
  Head-neck squamous cell carcinoma
  Hepatitis
  Hepatitis A virus infection
  Hepatitis B virus infection
  Hepatitis C virus infection
  Liver cancer
  Lung cancer
  Neoplasm
  Non-small-cell lung cancer
  Obesity
  Obsessive compulsive disorder
  Pancreatic cancer
  Prostate cancer
  Prostate neoplasm
  Refractive error
  rubella
  Schizophrenia
  Stomach cancer
  Advanced cancer
  Intellectual disability
  Parkinson disease
  Anemia
  Cutaneous mastocytosis
  Glaucoma/ocular hypertension
  leukaemia
  Leukemia
  Melanoma
  Psychotic disorder
  Type-1 diabetes
• UniProt ID: ARID2_HUMAN
• PDB ID: 7VDV; 7Y8R
• Pfam ID: PF01388 ; PF02257
• Sequence:
  MANSTGKAPPDERRKGLAFLDELRQFHHSRGSPFKKIPAVGGKELDLHGLYTRVTTLGGF
  AKVSEKNQWGEIVEEFNFPRSCSNAAFALKQYYLRYLEKYEKVHHFGEDDDEVPPGNPKP
  QLPIGAIPSSYNYQQHSVSDYLRQSYGLSMDFNSPNDYNKLVLSLLSGLPNEVDFAINVC
  TLLSNESKHVMQLEKDPKIITLLLANAGVFDDTLGSFSTVFGEEWKEKTDRDFVKFWKDI
  VDDNEVRDLISDRNKSHEGTSGEWIWESLFHPPRKLGINDIEGQRVLQIAVILRNLSFEE
  GNVKLLAANRTCLRFLLLSAHSHFISLRQLGLDTLGNIAAELLLDPVDFKTTHLMFHTVT
  KCLMSRDRFLKMRGMEILGNLCKAEDNGVLICEYVDQDSYREIICHLTLPDVLLVISTLE
  VLYMLTEMGDVACTKIAKVEKSIDMLVCLVSMDIQMFGPDALAAVKLIEHPSSSHQMLSE
  IRPQAIEQVQTQTHVASAPASRAVVAQHVAPPPGIVEIDSEKFACQWLNAHFEVNPDCSV
  SRAEMYSEYLSTCSKLARGGILTSTGFYKCLRTVFPNHTVKRVEDSSSNGQAHIHVVGVK
  RRAIPLPIQMYYQQQPVSTSVVRVDSVPDVSPAPSPAGIPHGSQTIGNHFQRTPVANQSS
  NLTATQMSFPVQGVHTVAQTVSRIPQNPSPHTHQQQNAPVTVIQSKAPIPCEVVKATVIQ
  NSIPQTGVPVSIAVGGGPPQSSVVQNHSTGPQPVTVVNSQTLLHHPSVIPQQSPLHTVVP
  GQIPSGTPVTVIQQAVPQSHMFGRVQNIPACTSTVSQGQQLITTSPQPVQTSSQQTSAGS
  QSQDTVIIAPPQYVTTSASNIVSATSVQNFQVATGQMVTIAGVPSPQASRVGFQNIAPKP
  LPSQQVSSTVVQQPIQQPQQPTQQSVVIVSQPAQQGQTYAPAIHQIVLANPAALPAGQTV
  QLTGQPNITPSSSPSPVPATNNQVPTAMSSSSTPQSQGPPPTVSQMLSVKRQQQQQHSPA
  PPPQQVQVQVQQPQQVQMQVQPQQSNAGVGQPASGESSLIKQLLLPKRGPSTPGGKLILP
  APQIPPPNNARAPSPQVVYQVASNQAAGFGVQGQTPAQQLLVGQQNVQLVPSAMPPSGGV
  QTVPISNLQILPGPLISNSPATIFQGTSGNQVTITVVPNTSFAPATVSQGNATQLIAPAG
  ITMSGTQTGVGLPVQTLPATQASPAGQSSCTTATPPFKGDKIICQKEEEAKEATGLHVHE
  RKIEVMENPSCRRGATNTSNGDTKENEMHVGSLLNGRKYSDSSLPPSNSGKIQSETNQCS
  LISNGPSLELGENGASGKQNSEQIDMQDIKSDLRKPLVNGICDFDKGDGSHLSKNIPNHK
  TSNHVGNGEISPMEPQGTLDITQQDTAKGDQLERISNGPVLTLGGSSVSSIQEASNAATQ
  QFSGTDLLNGPLASSLNSDVPQQRPSVVVSPHSTTSVIQGHQIIAVPDSGSKVSHSPALS
  SDVRSTNGTAECKTVKRPAEDTDRETVAGIPNKVGVRIVTISDPNNAGCSATMVAVPAGA
  DPSTVAKVAIESAVQQKQQHPPTYVQNVVPQNTPMPPSPAVQVQGQPNSSQPSPFSGSSQ
  PGDPMRKPGQNFMCLWQSCKKWFQTPSQVFYHAATEHGGKDVYPGQCLWEGCEPFQRQRF
  SFITHLQDKHCSKDALLAGLKQDEPGQAGSQKSSTKQPTVGGTSSTPRAQKAIVNHPSAA
  LMALRRGSRNLVFRDFTDEKEGPITKHIRLTAALILKNIGKYSECGRRLLKRHENNLSVL
  AISNMEASSTLAKCLYELNFTVQSKEQEKDSEMLQ
• Function: Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Required for the stability of the SWI/SNF chromatin remodeling complex SWI/SNF-B (PBAF). May be involved in targeting the complex to different genes. May be involved in regulating transcriptional activation of cardiac genes.
• Tissue Specificity: Highly expressed in heart.
• KEGG Pathway:
  ATP-dependent chromatin remodeling (hsa03082)
  Hepatocellular carcinoma (hsa05225)
• Reactome Pathway:
  RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known (R-HSA-8939243)
  RMTs methylate histone arginines (R-HSA-3214858)

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Coffin-Siris syndrome	DIS8L03H	Definitive	Autosomal dominant	[1]
Diabetic kidney disease	DISJMWEY	Definitive	Biomarker	[2]
Nephropathy	DISXWP4P	Definitive	Biomarker	[2]
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Biomarker	[2]
Type-1/2 diabetes	DISIUHAP	Definitive	Biomarker	[2]
Xeroderma pigmentosum group G	DIS4PV33	Definitive	Biomarker	[3]
Atrioventricular block	DIS8YLE6	Strong	Biomarker	[4]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[5]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Genetic Variation	[6]
Coffin-Siris syndrome 6	DISEPU0Q	Strong	Autosomal dominant	[7]
Familial adenomatous polyposis	DISW53RE	Strong	Genetic Variation	[8]
Gastric cancer	DISXGOUK	Strong	Biomarker	[9]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[10]
Hepatitis	DISXXX35	Strong	Altered Expression	[11]
Hepatitis A virus infection	DISUMFQV	Strong	Altered Expression	[11]
Hepatitis B virus infection	DISLQ2XY	Strong	Altered Expression	[12]
Hepatitis C virus infection	DISQ0M8R	Strong	Genetic Variation	[6]
Liver cancer	DISDE4BI	Strong	Genetic Variation	[6]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[6]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[13]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Genetic Variation	[6]
Obesity	DIS47Y1K	Strong	Biomarker	[14]
Obsessive compulsive disorder	DIS1ZMM2	Strong	Biomarker	[15]
Pancreatic cancer	DISJC981	Strong	Genetic Variation	[16]
Prostate cancer	DISF190Y	Strong	Biomarker	[17]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[17]
Refractive error	DISWNEQ1	Strong	Biomarker	[18]
rubella	DISXUI9P	Strong	Biomarker	[19]
Schizophrenia	DISSRV2N	Strong	Biomarker	[20]
Stomach cancer	DISKIJSX	Strong	Biomarker	[9]
Advanced cancer	DISAT1Z9	moderate	Genetic Variation	[3]
Intellectual disability	DISMBNXP	moderate	Genetic Variation	[21]
Parkinson disease	DISQVHKL	Disputed	Biomarker	[22]
Anemia	DISTVL0C	Limited	Biomarker	[23]
Cutaneous mastocytosis	DISLBZEF	Limited	Biomarker	[24]
Glaucoma/ocular hypertension	DISLBXBY	Limited	Biomarker	[25]
leukaemia	DISS7D1V	Limited	Biomarker	[23]
Leukemia	DISNAKFL	Limited	Biomarker	[23]
Melanoma	DIS1RRCY	Limited	Biomarker	[21]
Psychotic disorder	DIS4UQOT	Limited	Biomarker	[26]
Type-1 diabetes	DIS7HLUB	Limited	Altered Expression	[27]

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of AT-rich interactive domain-containing protein 2 (ARID2).	[28]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of AT-rich interactive domain-containing protein 2 (ARID2).	[39]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of AT-rich interactive domain-containing protein 2 (ARID2).	[41]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of AT-rich interactive domain-containing protein 2 (ARID2).	[42]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of AT-rich interactive domain-containing protein 2 (ARID2).	[41]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of AT-rich interactive domain-containing protein 2 (ARID2).	[29]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of AT-rich interactive domain-containing protein 2 (ARID2).	[30]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of AT-rich interactive domain-containing protein 2 (ARID2).	[31]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of AT-rich interactive domain-containing protein 2 (ARID2).	[32]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of AT-rich interactive domain-containing protein 2 (ARID2).	[33]
Panobinostat	DM58WKG	Approved	Panobinostat affects the expression of AT-rich interactive domain-containing protein 2 (ARID2).	[34]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of AT-rich interactive domain-containing protein 2 (ARID2).	[35]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of AT-rich interactive domain-containing protein 2 (ARID2).	[36]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of AT-rich interactive domain-containing protein 2 (ARID2).	[37]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of AT-rich interactive domain-containing protein 2 (ARID2).	[38]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of AT-rich interactive domain-containing protein 2 (ARID2).	[40]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of AT-rich interactive domain-containing protein 2 (ARID2).	[43]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of AT-rich interactive domain-containing protein 2 (ARID2).	[44]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Early growth response protein-1 upregulates long noncoding RNA Arid2-IR to promote extracellular matrix production in diabetic kidney disease.Am J Physiol Cell Physiol. 2019 Mar 1;316(3):C340-C352. doi: 10.1152/ajpcell.00167.2018. Epub 2018 Nov 21.
• [3] ARID2 modulates DNA damage response in human hepatocellular carcinoma cells.J Hepatol. 2017 May;66(5):942-951. doi: 10.1016/j.jhep.2016.12.026. Epub 2017 Feb 24.
• [4] Ro/SSA autoantibodies directly bind cardiomyocytes, disturb calcium homeostasis, and mediate congenital heart block.J Exp Med. 2005 Jan 3;201(1):11-7. doi: 10.1084/jem.20041859.
• [5] P50-N100-P200 sensory gating deficits in adolescents and young adults with autism spectrum disorders.Prog Neuropsychopharmacol Biol Psychiatry. 2019 Dec 20;95:109683. doi: 10.1016/j.pnpbp.2019.109683. Epub 2019 Jun 28.
• [6] Recurrent inactivating mutations of ARID2 in non-small cell lung carcinoma.Int J Cancer. 2013 May 1;132(9):2217-21. doi: 10.1002/ijc.27900. Epub 2012 Nov 20.
• [7] BAF200 is required for heart morphogenesis and coronary artery development. PLoS One. 2014 Oct 9;9(10):e109493. doi: 10.1371/journal.pone.0109493. eCollection 2014.
• [8] Whole-exome sequencing of duodenal adenocarcinoma identifies recurrent Wnt/-catenin signaling pathway mutations.Cancer. 2016 Jun 1;122(11):1689-96. doi: 10.1002/cncr.29974. Epub 2016 Mar 21.
• [9] Loss of ARID1A, ARID1B, and ARID2 Expression During Progression of Gastric Cancer.Anticancer Res. 2015 Dec;35(12):6819-27.
• [10] Mutational landscape of gingivo-buccal oral squamous cell carcinoma reveals new recurrently-mutated genes and molecular subgroups.Nat Commun. 2013;4:2873. doi: 10.1038/ncomms3873.
• [11] P200 family protein IFI204 negatively regulates type I interferon responses by targeting IRF7 in nucleus.PLoS Pathog. 2019 Oct 11;15(10):e1008079. doi: 10.1371/journal.ppat.1008079. eCollection 2019 Oct.
• [12] HBx protein-mediated ATOH1 downregulation suppresses ARID2 expression and promotes hepatocellular carcinoma.Cancer Sci. 2017 Jul;108(7):1328-1337. doi: 10.1111/cas.13277. Epub 2017 Jun 14.
• [13] Initial and crucial genetic events in intestinal-type gastric intramucosal neoplasia.J Pathol. 2019 Apr;247(4):494-504. doi: 10.1002/path.5208. Epub 2019 Jan 16.
• [14] Common Molecular Subtypes Among Asian Hepatocellular Carcinoma and Cholangiocarcinoma.Cancer Cell. 2017 Jul 10;32(1):57-70.e3. doi: 10.1016/j.ccell.2017.05.009. Epub 2017 Jun 22.
• [15] Neuropsychological, electrophysiological and neurological impairments in patients with obsessive compulsive disorder, their healthy siblings and healthy controls: Identifying potential endophenotype(s).Psychiatry Res. 2016 Jun 30;240:110-117. doi: 10.1016/j.psychres.2016.04.013. Epub 2016 Apr 7.
• [16] Genetic variants in the SWI/SNF complex and smoking collaborate to modify the risk of pancreatic cancer in a Chinese population.Mol Carcinog. 2015 Sep;54(9):761-8. doi: 10.1002/mc.22140. Epub 2014 Feb 28.
• [17] The long tail of oncogenic drivers in prostate cancer.Nat Genet. 2018 May;50(5):645-651. doi: 10.1038/s41588-018-0078-z. Epub 2018 Apr 2.
• [18] Meta-analysis of gene-environment-wide association scans accounting for education level identifies additional loci for refractive error.Nat Commun. 2016 Mar 29;7:11008. doi: 10.1038/ncomms11008.
• [19] Determinants in the maturation of rubella virus p200 replicase polyprotein precursor.J Virol. 2012 Jun;86(12):6457-69. doi: 10.1128/JVI.06132-11. Epub 2012 Apr 4.
• [20] Selective attention and mismatch negativity in antipsychotic-nave, first-episode schizophrenia patients before and after 6 months of antipsychotic monotherapy.Psychol Med. 2017 Sep;47(12):2155-2165. doi: 10.1017/S0033291717000599. Epub 2017 Apr 26.
• [21] Patient with anomalous skin pigmentation expands the phenotype of ARID2 loss-of-function disorder, a SWI/SNF-related intellectual disability.Am J Med Genet A. 2019 May;179(5):808-812. doi: 10.1002/ajmg.a.61075. Epub 2019 Mar 5.
• [22] Altered N100-potential associates with working memory impairment in Parkinson's disease.J Neural Transm (Vienna). 2017 Oct;124(10):1197-1203. doi: 10.1007/s00702-017-1758-z. Epub 2017 Jul 14.
• [23] The chromatin remodeling subunit Baf200 promotes normal hematopoiesis and inhibits leukemogenesis.J Hematol Oncol. 2018 Feb 26;11(1):27. doi: 10.1186/s13045-018-0567-7.
• [24] Electrophysiological evidence of language switching for bidialectals: an event-related potential study.Neuroreport. 2018 Feb 7;29(3):181-190. doi: 10.1097/WNR.0000000000000950.
• [25] Ex-PRESS implantation for different types of glaucoma.Int J Ophthalmol. 2019 Aug 18;12(8):1290-1297. doi: 10.18240/ijo.2019.08.09. eCollection 2019.
• [26] Similar effect of family history of psychosis on Sylvian fissure size and auditory P200 amplitude in schizophrenic and bipolar subjects.Psychiatry Res. 2001 Nov 5;108(1):29-38. doi: 10.1016/s0925-4927(01)00113-5.
• [27] microRNA?6 regulates the proliferation of nucleus pulposus cells by targeting ARID2/AKT signaling.Mol Med Rep. 2017 Nov;16(5):7553-7560. doi: 10.3892/mmr.2017.7560. Epub 2017 Sep 20.
• [28] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [29] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [30] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [31] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [32] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [33] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [34] The Bromodomain Inhibitor JQ1 and the Histone Deacetylase Inhibitor Panobinostat Synergistically Reduce N-Myc Expression and Induce Anticancer Effects. Clin Cancer Res. 2016 May 15;22(10):2534-44. doi: 10.1158/1078-0432.CCR-15-1666. Epub 2016 Jan 5.
• [35] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [36] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [37] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
• [38] Synergistic effect of JQ1 and rapamycin for treatment of human osteosarcoma. Int J Cancer. 2015 May 1;136(9):2055-64.
• [39] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [40] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [41] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [42] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [43] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [44] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.