Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJSIGV5)

• DOT Name: ATP-binding cassette sub-family C member 2 (ABCC2)
• Synonyms: EC 7.6.2.-; EC 7.6.2.2; EC 7.6.2.3; Canalicular multidrug resistance protein; Canalicular multispecific organic anion transporter 1; Multidrug resistance-associated protein 2
• Gene Name: ABCC2
• Related Disease: Dubin-Johnson syndrome
• UniProt ID: MRP2_HUMAN
• EC Number: 7.6.2.-; 7.6.2.2; 7.6.2.3
• Pfam ID: PF00664 ; PF00005
• Sequence:
  MLEKFCNSTFWNSSFLDSPEADLPLCFEQTVLVWIPLGYLWLLAPWQLLHVYKSRTKRSS
  TTKLYLAKQVFVGFLLILAAIELALVLTEDSGQATVPAVRYTNPSLYLGTWLLVLLIQYS
  RQWCVQKNSWFLSLFWILSILCGTFQFQTLIRTLLQGDNSNLAYSCLFFISYGFQILILI
  FSAFSENNESSNNPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVS
  KFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSG
  TKKDVPKSWLMKALFKTFYMVLLKSFLLKLVNDIFTFVSPQLLKLLISFASDRDTYLWIG
  YLCAILLFTAALIQSFCLQCYFQLCFKLGVKVRTAIMASVYKKALTLSNLARKEYTVGET
  VNLMSVDAQKLMDVTNFMHMLWSSVLQIVLSIFFLWRELGPSVLAGVGVMVLVIPINAIL
  STKSKTIQVKNMKNKDKRLKIMNEILSGIKILKYFAWEPSFRDQVQNLRKKELKNLLAFS
  QLQCVVIFVFQLTPVLVSVVTFSVYVLVDSNNILDAQKAFTSITLFNILRFPLSMLPMMI
  SSMLQASVSTERLEKYLGGDDLDTSAIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLD
  IMAGQLVAVIGPVGSGKSSLISAMLGEMENVHGHITIKGTTAYVPQQSWIQNGTIKDNIL
  FGTEFNEKRYQQVLEACALLPDLEMLPGGDLAEIGEKGINLSGGQKQRISLARATYQNLD
  IYLLDDPLSAVDAHVGKHIFNKVLGPNGLLKGKTRLLVTHSMHFLPQVDEIVVLGNGTIV
  EKGSYSALLAKKGEFAKNLKTFLRHTGPEEEATVHDGSEEEDDDYGLISSVEEIPEDAAS
  ITMRRENSFRRTLSRSSRSNGRHLKSLRNSLKTRNVNSLKEDEELVKGQKLIKKEFIETG
  KVKFSIYLEYLQAIGLFSIFFIILAFVMNSVAFIGSNLWLSAWTSDSKIFNSTDYPASQR
  DMRVGVYGALGLAQGIFVFIAHFWSAFGFVHASNILHKQLLNNILRAPMRFFDTTPTGRI
  VNRFAGDISTVDDTLPQSLRSWITCFLGIISTLVMICMATPVFTIIVIPLGIIYVSVQMF
  YVSTSRQLRRLDSVTRSPIYSHFSETVSGLPVIRAFEHQQRFLKHNEVRIDTNQKCVFSW
  ITSNRWLAIRLELVGNLTVFFSALMMVIYRDTLSGDTVGFVLSNALNITQTLNWLVRMTS
  EIETNIVAVERITEYTKVENEAPWVTDKRPPPDWPSKGKIQFNNYQVRYRPELDLVLRGI
  TCDIGSMEKIGVVGRTGAGKSSLTNCLFRILEAAGGQIIIDGVDIASIGLHDLREKLTII
  PQDPILFSGSLRMNLDPFNNYSDEEIWKALELAHLKSFVASLQLGLSHEVTEAGGNLSIG
  QRQLLCLGRALLRKSKILVLDEATAAVDLETDNLIQTTIQNEFAHCTVITIAHRLHTIMD
  SDKVMVLDNGKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF
• Function: ATP-dependent transporter of the ATP-binding cassette (ABC) family that binds and hydrolyzes ATP to enable active transport of various substrates including many drugs, toxicants and endogenous compound across cell membranes. Transports a wide variety of conjugated organic anions such as sulfate-, glucuronide- and glutathione (GSH)-conjugates of endo- and xenobiotics substrates. Mediates hepatobiliary excretion of mono- and bis-glucuronidated bilirubin molecules and therefore play an important role in bilirubin detoxification. Mediates also hepatobiliary excretion of others glucuronide conjugates such as 17beta-estradiol 17-glucosiduronic acid and leukotriene C4. Transports sulfated bile salt such as taurolithocholate sulfate. Transports various anticancer drugs, such as anthracycline, vinca alkaloid and methotrexate and HIV-drugs such as protease inhibitors. Confers resistance to several anti-cancer drugs including cisplatin, doxorubicin, epirubicin, methotrexate, etoposide and vincristine.
• Tissue Specificity: Expressed by polarized cells in liver, kidney and intestine. The highest expression is found in liver. Expressed in small intestine .
• KEGG Pathway:
  Antifolate resistance (hsa01523)
  Platinum drug resistance (hsa01524)
  ABC transporters (hsa02010)
  Bile secretion (hsa04976)
• Reactome Pathway:
  ABC-family proteins mediated transport (R-HSA-382556)
  Defective ABCC2 causes DJS (R-HSA-5679001)
  Aspirin ADME (R-HSA-9749641)
  Paracetamol ADME (R-HSA-9753281)
  Atorvastatin ADME (R-HSA-9754706)
  Heme degradation (R-HSA-189483)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Dubin-Johnson syndrome	DISM8TG9	Strong	Autosomal recessive	[1]

This DOT Affected the Drug Response of 12 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Ivermectin	DMDBX5F	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) increases the Cell-mediated cytotoxicity ADR of Ivermectin.	[68]
Temozolomide	DMKECZD	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) affects the response to substance of Temozolomide.	[69]
Fluorouracil	DMUM7HZ	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) affects the response to substance of Fluorouracil.	[70]
Irinotecan	DMP6SC2	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) decreases the response to substance of Irinotecan.	[72]
Paclitaxel	DMLB81S	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) decreases the response to substance of Paclitaxel.	[41]
DTI-015	DMXZRW0	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) affects the response to substance of DTI-015.	[69]
Daunorubicin	DMQUSBT	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) affects the response to substance of Daunorubicin.	[73]
Phenytoin	DMNOKBV	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) affects the response to substance of Phenytoin.	[74]
Sorafenib	DMS8IFC	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) affects the response to substance of Sorafenib.	[75]
Docetaxel	DMDI269	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) increases the Leukopenia ADR of Docetaxel.	[76]
Fosinopril	DM9NJ52	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) decreases the response to substance of Fosinopril.	[82]
DNCB	DMDTVYC	Phase 2	ATP-binding cassette sub-family C member 2 (ABCC2) decreases the response to substance of DNCB.	[84]

This DOT Affected the Regulation of Drug Effects of 18 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Etoposide	DMNH3PG	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) affects the transport of Etoposide.	[71]
Vinblastine	DM5TVS3	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) affects the transport of Vinblastine.	[41]
Adenosine triphosphate	DM79F6G	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) affects the metabolism of Adenosine triphosphate.	[77]
Glutathione	DMAHMT9	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) affects the transport of Glutathione.	[78]
Chlorambucil	DMRKE63	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) affects the export of Chlorambucil.	[42]
Nelfinavir mesylate	DMFX6G8	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) affects the transport of Nelfinavir mesylate.	[79]
Ethacrynic acid	DM60QMR	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) increases the transport of Ethacrynic acid.	[80]
Lopinavir	DMITQS0	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) increases the abundance of Lopinavir.	[77]
Pitavastatin	DMJH792	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) affects the transport of Pitavastatin.	[81]
Succimer	DME81IY	Approved	ATP-binding cassette sub-family C member 2 (ABCC2) increases the transport of Succimer.	[83]
Vadimezan	DMK7CYX	Phase 2	ATP-binding cassette sub-family C member 2 (ABCC2) affects the export of Vadimezan.	[85]
PKI166	DMSQ794	Discontinued in Phase 2	ATP-binding cassette sub-family C member 2 (ABCC2) affects the transport of PKI166.	[86]
Microcystin-LR	DMTMLRN	Investigative	ATP-binding cassette sub-family C member 2 (ABCC2) increases the export of Microcystin-LR.	[87]
[3H]estrone-3-sulphate	DMGPF0N	Investigative	ATP-binding cassette sub-family C member 2 (ABCC2) affects the export of [3H]estrone-3-sulphate.	[88]
Ginsenoside Re	DM46FVD	Investigative	ATP-binding cassette sub-family C member 2 (ABCC2) increases the transport of Ginsenoside Re.	[89]
G418	DMKTJBU	Investigative	ATP-binding cassette sub-family C member 2 (ABCC2) increases the transport of G418.	[90]
LTC4	DM702WR	Investigative	ATP-binding cassette sub-family C member 2 (ABCC2) affects the transport of LTC4.	[91]
6-Carboxyfluorescein	DMWTMDH	Investigative	ATP-binding cassette sub-family C member 2 (ABCC2) affects the export of 6-Carboxyfluorescein.	[92]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of ATP-binding cassette sub-family C member 2 (ABCC2).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of ATP-binding cassette sub-family C member 2 (ABCC2).	[52]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of ATP-binding cassette sub-family C member 2 (ABCC2).	[54]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of ATP-binding cassette sub-family C member 2 (ABCC2).	[54]

83 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[6]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[7]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[8]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[9]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[10]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[11]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[12]
Carbamazepine	DMZOLBI	Approved	Carbamazepine increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[13]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[14]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[15]
Phenobarbital	DMXZOCG	Approved	Phenobarbital increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[16]
Progesterone	DMUY35B	Approved	Progesterone decreases the activity of ATP-binding cassette sub-family C member 2 (ABCC2).	[17]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[18]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[19]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[20]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[21]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[22]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[23]
Diclofenac	DMPIHLS	Approved	Diclofenac increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[21]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[24]
Indomethacin	DMSC4A7	Approved	Indomethacin decreases the activity of ATP-binding cassette sub-family C member 2 (ABCC2).	[25]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[26]
Simvastatin	DM30SGU	Approved	Simvastatin decreases the activity of ATP-binding cassette sub-family C member 2 (ABCC2).	[27]
Topotecan	DMP6G8T	Approved	Topotecan increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[28]
Rifampicin	DM5DSFZ	Approved	Rifampicin increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[29]
Ursodeoxycholic acid	DMCUT21	Approved	Ursodeoxycholic acid increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[30]
Fluoxetine	DM3PD2C	Approved	Fluoxetine increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[31]
Chenodiol	DMQ8JIK	Approved	Chenodiol increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[32]
Bosentan	DMIOGBU	Approved	Bosentan decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[33]
Lovastatin	DM9OZWQ	Approved	Lovastatin decreases the activity of ATP-binding cassette sub-family C member 2 (ABCC2).	[27]
Bezafibrate	DMZDCS0	Approved	Bezafibrate increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[34]
Ximelegatran	DMU8ANS	Approved	Ximelegatran increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[35]
Atazanavir	DMSYRBX	Approved	Atazanavir decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[36]
Clotrimazole	DMMFCIH	Approved	Clotrimazole increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[29]
Clavulanate	DM2FGRT	Approved	Clavulanate increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[37]
Epirubicin	DMPDW6T	Approved	Epirubicin increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[38]
Citalopram	DM2G9AE	Approved	Citalopram increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[39]
Methoxsalen	DME8FZ9	Approved	Methoxsalen decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[40]
Benzbromarone	DMC3YUA	Approved	Benzbromarone decreases the activity of ATP-binding cassette sub-family C member 2 (ABCC2).	[25]
Cholic acid	DM7OKQV	Approved	Cholic acid increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[32]
Paroxetine	DM5PVQE	Approved	Paroxetine increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[39]
Probenecid	DMMFWOJ	Approved	Probenecid increases the activity of ATP-binding cassette sub-family C member 2 (ABCC2).	[41]
Bromfenac	DMKB79O	Approved	Bromfenac decreases the activity of ATP-binding cassette sub-family C member 2 (ABCC2).	[25]
Sulfinpyrazone	DMEV954	Approved	Sulfinpyrazone decreases the activity of ATP-binding cassette sub-family C member 2 (ABCC2).	[42]
Tolvaptan	DMIWFRL	Approved	Tolvaptan decreases the activity of ATP-binding cassette sub-family C member 2 (ABCC2).	[43]
Macitentan	DMP79A1	Approved	Macitentan decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[33]
Norgestimate	DMYP4XC	Approved	Norgestimate decreases the activity of ATP-binding cassette sub-family C member 2 (ABCC2).	[17]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[44]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[45]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the activity of ATP-binding cassette sub-family C member 2 (ABCC2).	[46]
Atorvastatin	DMF28YC	Phase 3 Trial	Atorvastatin decreases the activity of ATP-binding cassette sub-family C member 2 (ABCC2).	[27]
Chloroquine	DMSI5CB	Phase 3 Trial	Chloroquine decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[47]
Triptolide	DMCMDVR	Phase 3	Triptolide decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[48]
5-methoxypsoralen	DME2A8X	Phase 3	5-methoxypsoralen decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[40]
Rubitecan	DMDWU1S	Phase 3	Rubitecan increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[49]
TAK-875	DMIM5AP	Phase 3	TAK-875 decreases the activity of ATP-binding cassette sub-family C member 2 (ABCC2).	[50]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[51]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[53]
PMID26394986-Compound-22	DM43Z1G	Patented	PMID26394986-Compound-22 decreases the activity of ATP-binding cassette sub-family C member 2 (ABCC2).	[25]
PMID26560530-Compound-34	DMLGZPO	Patented	PMID26560530-Compound-34 increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[16]
FINROZOLE	DM06SC9	Discontinued in Phase 2	FINROZOLE increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[55]
BMS 536924	DMDJH2L	Preclinical	BMS 536924 decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[45]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[56]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[57]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[58]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[59]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[60]
Forskolin	DM6ITNG	Investigative	Forskolin increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[7]
Chrysin	DM7V2LG	Investigative	Chrysin decreases the activity of ATP-binding cassette sub-family C member 2 (ABCC2).	[28]
2-tert-butylbenzene-1,4-diol	DMNXI1E	Investigative	2-tert-butylbenzene-1,4-diol increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[29]
	DM9CEI5		increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[19]
Myricetin	DMTV4L0	Investigative	Myricetin decreases the activity of ATP-binding cassette sub-family C member 2 (ABCC2).	[61]
DEMETHOXYCURCUMIN	DMO5UGV	Investigative	DEMETHOXYCURCUMIN decreases the activity of ATP-binding cassette sub-family C member 2 (ABCC2).	[46]
Icariside II	DM3DB8X	Investigative	Icariside II decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[62]
Formononetin	DM7WFZ8	Investigative	Formononetin decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[63]
chlordane	DMMHU8G	Investigative	chlordane increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[64]
6-bromoindirubin-3-oxime	DM12WYV	Investigative	6-bromoindirubin-3-oxime increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[65]
7,3',4'-trihydroxyisoflavone	DM5JV8G	Investigative	7,3',4'-trihydroxyisoflavone decreases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[66]
GINKGOLIDE A	DMKZJ7T	Investigative	GINKGOLIDE A increases the expression of ATP-binding cassette sub-family C member 2 (ABCC2).	[67]
ROBINETIN	DMASOWP	Investigative	ROBINETIN decreases the activity of ATP-binding cassette sub-family C member 2 (ABCC2).	[61]

References

• [1] Neonatal Dubin-Johnson syndrome: long-term follow-up and MRP2 mutations study. Pediatr Res. 2006 Apr;59(4 Pt 1):584-9. doi: 10.1203/01.pdr.0000203093.10908.bb.
• [2] Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Evaluation of drug transporters' significance for multidrug resistance in head and neck squamous cell carcinoma. Head Neck. 2011 Jul;33(7):959-68. doi: 10.1002/hed.21559. Epub 2010 Aug 24.
• [7] Induction of cells differentiation and ABC transporters expression by a myco-estrogen, zearalenone, in human choriocarcinoma cell line (BeWo). Toxicology. 2009 Sep 19;263(2-3):100-7. doi: 10.1016/j.tox.2009.06.023. Epub 2009 Jul 4.
• [8] Combined effects of arsenic and palmitic acid on oxidative stress and lipid metabolism disorder in human hepatoma HepG2 cells. Sci Total Environ. 2021 May 15;769:144849. doi: 10.1016/j.scitotenv.2020.144849. Epub 2021 Jan 19.
• [9] In vitro study of transporters involved in intestinal absorption of inorganic arsenic. Chem Res Toxicol. 2012 Feb 20;25(2):446-53. doi: 10.1021/tx200491f. Epub 2012 Jan 26.
• [10] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [11] Vitamin D3 transactivates the zinc and manganese transporter SLC30A10 via the Vitamin D receptor. J Steroid Biochem Mol Biol. 2016 Oct;163:77-87.
• [12] Primary Human Hepatocyte Spheroids as Tools to Study the Hepatotoxic Potential of Non-Pharmaceutical Chemicals. Int J Mol Sci. 2021 Oct 12;22(20):11005. doi: 10.3390/ijms222011005.
• [13] Carbamazepine regulates intestinal P-glycoprotein and multidrug resistance protein MRP2 and influences disposition of talinolol in humans. Clin Pharmacol Ther. 2004 Sep;76(3):192-200.
• [14] Methotrexate normalizes up-regulated folate pathway genes in rheumatoid arthritis. Arthritis Rheum. 2013 Nov;65(11):2791-802.
• [15] Methylation-dependent silencing of the reduced folate carrier gene in inherently methotrexate-resistant human breast cancer cells. J Biol Chem. 2001 Oct 26;276(43):39990-40000.
• [16] Differential regulation of sinusoidal and canalicular hepatic drug transporter expression by xenobiotics activating drug-sensing receptors in primary human hepatocytes. Drug Metab Dispos. 2006 Oct;34(10):1756-63. doi: 10.1124/dmd.106.010033. Epub 2006 Jul 12.
• [17] Interaction of progestins with the human multidrug resistance-associated protein 2 (MRP2). Drug Metab Dispos. 2005 Nov;33(11):1576-9.
• [18] Regulation of expression and activity of multidrug resistance proteins MRP2 and MDR1 by estrogenic compounds in Caco-2 cells. Role in prevention of xenobiotic-induced cytotoxicity. Toxicology. 2014 Jun 5;320:46-55. doi: 10.1016/j.tox.2014.03.007. Epub 2014 Mar 28.
• [19] The role of lithocholic acid in the regulation of bile acid detoxication, synthesis, and transport proteins in rat and human intestine and liver slices. Toxicol In Vitro. 2011 Feb;25(1):80-90.
• [20] Proteasome inhibitors MG-132 and bortezomib induce AKR1C1, AKR1C3, AKR1B1, and AKR1B10 in human colon cancer cell lines SW-480 and HT-29. Chem Biol Interact. 2011 May 30;191(1-3):239-49.
• [21] Species-specific toxicity of diclofenac and troglitazone in primary human and rat hepatocytes. Chem Biol Interact. 2009 Apr 15;179(1):17-24.
• [22] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [23] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [24] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [25] In vitro approach to assess the potential for risk of idiosyncratic adverse reactions caused by candidate drugs. Chem Res Toxicol. 2012 Aug 20;25(8):1616-32. doi: 10.1021/tx300091x. Epub 2012 May 31.
• [26] UDCA and CDCA alleviate 17-ethinylestradiol-induced cholestasis through PKA-AMPK pathways in rats. Toxicol Appl Pharmacol. 2016 Nov 15;311:12-25. doi: 10.1016/j.taap.2016.10.011. Epub 2016 Oct 12.
• [27] Differential interaction of 3-hydroxy-3-methylglutaryl-coa reductase inhibitors with ABCB1, ABCC2, and OATP1B1. Drug Metab Dispos. 2005 Apr;33(4):537-46.
• [28] Chrysin blocks topotecan-induced apoptosis in Caco-2 cells in spite of inhibition of ABC-transporters. Biochem Pharmacol. 2010 Aug 15;80(4):471-9. doi: 10.1016/j.bcp.2010.04.038. Epub 2010 May 8.
• [29] Influence of redox-active compounds and PXR-activators on human MRP1 and MRP2 gene expression. Toxicology. 2002 Feb 28;171(2-3):137-46.
• [30] Chemiluminescence quantitative immunohistochemical determination of MRP2 in liver biopsies. J Histochem Cytochem. 2005 Dec;53(12):1451-7. doi: 10.1369/jhc.5A6621.2005. Epub 2005 Jun 13.
• [31] Screening autism-associated environmental factors in differentiating human neural progenitors with fractional factorial design-based transcriptomics. Sci Rep. 2023 Jun 29;13(1):10519. doi: 10.1038/s41598-023-37488-0.
• [32] Potency of individual bile acids to regulate bile acid synthesis and transport genes in primary human hepatocyte cultures. Toxicol Sci. 2014 Oct;141(2):538-46. doi: 10.1093/toxsci/kfu151. Epub 2014 Jul 23.
• [33] From the Cover: MechanisticInsights in Cytotoxic and Cholestatic Potential of the Endothelial Receptor Antagonists Using HepaRG Cells. Toxicol Sci. 2017 Jun 1;157(2):451-464. doi: 10.1093/toxsci/kfx062.
• [34] Bezafibrate stimulates canalicular localization of NBD-labeled PC in HepG2 cells by PPARalpha-mediated redistribution of ABCB4. J Lipid Res. 2004 Oct;45(10):1813-25. doi: 10.1194/jlr.M400132-JLR200. Epub 2004 Jul 16.
• [35] Pharmacological inhibition of Rho-kinase (ROCK) signaling enhances cisplatin resistance in neuroblastoma cells. Int J Oncol. 2010 Nov;37(5):1297-305. doi: 10.3892/ijo_00000781.
• [36] Robustness testing and optimization of an adverse outcome pathway on cholestatic liver injury. Arch Toxicol. 2020 Apr;94(4):1151-1172. doi: 10.1007/s00204-020-02691-9. Epub 2020 Mar 10.
• [37] Molecular mechanisms of hepatotoxic cholestasis by clavulanic acid: Role of NRF2 and FXR pathways. Food Chem Toxicol. 2021 Dec;158:112664. doi: 10.1016/j.fct.2021.112664. Epub 2021 Nov 9.
• [38] Co-encapsulation of chrysophsin-1 and epirubicin in PEGylated liposomes circumvents multidrug resistance in HeLa cells. Chem Biol Interact. 2015 Dec 5;242:13-23. doi: 10.1016/j.cbi.2015.08.023. Epub 2015 Sep 1.
• [39] Antidepressant induced cholestasis: hepatocellular redistribution of multidrug resistant protein (MRP2). Gut. 2003 Feb;52(2):300-3. doi: 10.1136/gut.52.2.300.
• [40] ABC-transporter blockage mediated by xanthotoxin and bergapten is the major pathway for chemosensitization of multidrug-resistant cancer cells. Toxicol Appl Pharmacol. 2017 Dec 15;337:22-29. doi: 10.1016/j.taap.2017.10.018. Epub 2017 Oct 25.
• [41] MRP2 (ABCC2) transports taxanes and confers paclitaxel resistance and both processes are stimulated by probenecid. Int J Cancer. 2005 Sep 20;116(5):824-9. doi: 10.1002/ijc.21013.
• [42] Role of multidrug resistance protein 2 (MRP2, ABCC2) in alkylating agent detoxification: MRP2 potentiates glutathione S-transferase A1-1-mediated resistance to chlorambucil cytotoxicity. J Pharmacol Exp Ther. 2004 Jan;308(1):260-7. doi: 10.1124/jpet.103.057729. Epub 2003 Oct 20.
• [43] Inhibition of Human Hepatic Bile Acid Transporters by Tolvaptan and Metabolites: Contributing Factors to Drug-Induced Liver Injury?. Toxicol Sci. 2016 Jan;149(1):237-50. doi: 10.1093/toxsci/kfv231. Epub 2015 Oct 26.
• [44] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [45] Enhancement effect of resveratrol on the intestinal absorption of bestatin by regulating PEPT1, MDR1 and MRP2 in vivo and in vitro. Int J Pharm. 2015 Nov 10;495(1):588-598. doi: 10.1016/j.ijpharm.2015.09.042. Epub 2015 Sep 21.
• [46] Inhibition of multidrug resistance proteins MRP1 and MRP2 by a series of alpha,beta-unsaturated carbonyl compounds. Biochem Pharmacol. 2005 Jun 15;69(12):1879-90. doi: 10.1016/j.bcp.2005.04.001.
• [47] Autophagy inhibition upregulates CD4(+) tumor infiltrating lymphocyte expression via miR-155 regulation and TRAIL activation. Mol Oncol. 2016 Dec;10(10):1516-1531. doi: 10.1016/j.molonc.2016.08.005. Epub 2016 Sep 16.
• [48] Variable p53/Nrf2 crosstalk contributes to triptolide-induced hepatotoxic process. Toxicol Lett. 2023 Apr 15;379:67-75. doi: 10.1016/j.toxlet.2023.03.011. Epub 2023 Mar 28.
• [49] Analysis of ATP-binding cassette transporter expression in drug-selected cell lines by a microarray dedicated to multidrug resistance. Mol Pharmacol. 2004 Dec;66(6):1397-405. doi: 10.1124/mol.104.005009. Epub 2004 Sep 1.
• [50] Fasiglifam (TAK-875) Alters Bile Acid Homeostasis in Rats and Dogs: A Potential Cause of Drug Induced Liver Injury. Toxicol Sci. 2017 May 1;157(1):50-61. doi: 10.1093/toxsci/kfx018.
• [51] Resveratrol inhibits genistein-induced multi-drug resistance protein 2 (MRP2) expression in HepG2 cells. Arch Biochem Biophys. 2011 Aug 15;512(2):160-6. doi: 10.1016/j.abb.2011.06.004. Epub 2011 Jun 12.
• [52] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [53] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [54] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [55] The effects of aflatoxin B1 on transporters and steroid metabolizing enzymes in JEG-3 cells. Toxicol Lett. 2013 Apr 26;218(3):200-6.
• [56] Effects of endocrine disruptors on genes associated with 17beta-estradiol metabolism and excretion. Steroids. 2008 Nov;73(12):1242-51.
• [57] Characterization of the 5'-flanking region of the human multidrug resistance protein 2 (MRP2) gene and its regulation in comparison withthe multidrug resistance protein 3 (MRP3) gene. Eur J Biochem. 2000 Mar;267(5):1347-58. doi: 10.1046/j.1432-1327.2000.01106.x.
• [58] Reactive oxygen species-related induction of multidrug resistance-associated protein 2 expression in primary hepatocytes exposed to sulforaphane. Biochem Biophys Res Commun. 2001 Mar 23;282(1):257-63. doi: 10.1006/bbrc.2001.4531.
• [59] Modulation of the xenobiotic transformation system and inflammatory response by ochratoxin A exposure using a co-culture system of Caco-2 and HepG2 cells. Food Chem Toxicol. 2015 Dec;86:245-52.
• [60] ABCG2/BCRP decreases the transfer of a food-born chemical carcinogen, 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine (PhIP) in perfused term human placenta. Toxicol Appl Pharmacol. 2008 Oct 15;232(2):210-7. doi: 10.1016/j.taap.2008.07.006. Epub 2008 Jul 18.
• [61] Quantitative structure activity relationship studies on the flavonoid mediated inhibition of multidrug resistance proteins 1 and 2. Biochem Pharmacol. 2005 Feb 15;69(4):699-708. doi: 10.1016/j.bcp.2004.11.002. Epub 2004 Dec 23.
• [62] Baohuoside I inhibits FXR signaling pathway to interfere with bile acid homeostasis via targeting ER degradation. Cell Biol Toxicol. 2023 Aug;39(4):1215-1235. doi: 10.1007/s10565-022-09737-x. Epub 2022 Jul 8.
• [63] Formononetin potentiates epirubicin-induced apoptosis via ROS production in HeLa cells in vitro. Chem Biol Interact. 2013 Oct 5;205(3):188-97. doi: 10.1016/j.cbi.2013.07.003. Epub 2013 Jul 16.
• [64] Regulation of hepatic drug transporter activity and expression by organochlorine pesticides. J Biochem Mol Toxicol. 2014 Mar;28(3):119-28.
• [65] Activation of beta-catenin signalling by GSK-3 inhibition increases p-glycoprotein expression in brain endothelial cells. J Neurochem. 2008 Aug;106(4):1855-65. doi: 10.1111/j.1471-4159.2008.05537.x. Epub 2008 Jul 4.
• [66] 7,3',4'-Trihydroxyisoflavone modulates multidrug resistance transporters and induces apoptosis via production of reactive oxygen species. Toxicology. 2012 Dec 16;302(2-3):221-32. doi: 10.1016/j.tox.2012.08.003. Epub 2012 Aug 15.
• [67] Bioactive terpenoids and flavonoids from Ginkgo biloba extract induce the expression of hepatic drug-metabolizing enzymes through pregnane X receptor, constitutive androstane receptor, and aryl hydrocarbon receptor-mediated pathways. Pharm Res. 2009 Apr;26(4):872-82.
• [68] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
• [69] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.
• [70] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [71] Resistance to topoisomerase II inhibitors in human glioma cell lines overexpressing multidrug resistant associated protein (MRP) 2. J Med Invest. 2005 Feb;52(1-2):41-8. doi: 10.2152/jmi.52.41.
• [72] A mechanistic study on reduced toxicity of irinotecan by coadministered thalidomide, a tumor necrosis factor-alpha inhibitor. J Pharmacol Exp Ther. 2006 Oct;319(1):82-104. doi: 10.1124/jpet.106.103606. Epub 2006 Jun 30.
• [73] Genetic variants contributing to daunorubicin-induced cytotoxicity. Cancer Res. 2008 May 1;68(9):3161-8. doi: 10.1158/0008-5472.CAN-07-6381.
• [74] Intestinal expression of cytochrome P450 enzymes and ABC transporters and carbamazepine and phenytoin disposition. Acta Neurol Scand. 2007 Apr;115(4):232-42. doi: 10.1111/j.1600-0404.2006.00761.x.
• [75] The Enhanced metastatic potential of hepatocellular carcinoma (HCC) cells with sorafenib resistance. PLoS One. 2013 Nov 11;8(11):e78675. doi: 10.1371/journal.pone.0078675. eCollection 2013.
• [76] Association of genetic polymorphisms in SLCO1B3 and ABCC2 with docetaxel-induced leukopenia. Cancer Sci. 2008 May;99(5):967-72.
• [77] Functional defect caused by the 4544G>A SNP in ABCC2: potential impact for drug cellular disposition. Pharmacogenet Genomics. 2011 Dec;21(12):884-93. doi: 10.1097/FPC.0b013e32834d672b.
• [78] Selenium-dependent and -independent transport of arsenic by the human multidrug resistance protein 2 (MRP2/ABCC2): implications for the mutual detoxification of arsenic and selenium. Carcinogenesis. 2010 Aug;31(8):1450-5. doi: 10.1093/carcin/bgq125. Epub 2010 Jun 27.
• [79] Influence of ABCB1, ABCC1, ABCC2, and ABCG2 haplotypes on the cellular exposure of nelfinavir in vivo. Pharmacogenet Genomics. 2005 Sep;15(9):599-608. doi: 10.1097/01.fpc.0000172241.42546.d3.
• [80] Effects of fibrates on human organic anion-transporting polypeptide 1B1-, multidrug resistance protein 2- and P-glycoprotein-mediated transport. Xenobiotica. 2005 Jul;35(7):737-53.
• [81] Involvement of BCRP (ABCG2) in the biliary excretion of pitavastatin. Mol Pharmacol. 2005 Sep;68(3):800-7.
• [82] Mrp2 is involved in the efflux and disposition of fosinopril. J Appl Toxicol. 2013 Jun;33(6):458-65. doi: 10.1002/jat.1767. Epub 2011 Nov 17.
• [83] MRP2 involvement in renal proximal tubular elimination of methylmercury mediated by DMPS or DMSA. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):10-7.
• [84] Coordinated induction of GST and MRP2 by cAMP in Caco-2 cells: role of protein kinase A signaling pathway and toxicological relevance. Toxicol Appl Pharmacol. 2015 Sep 1;287(2):178-190.
• [85] Transport of the investigational anti-cancer drug 5,6-dimethylxanthenone-4-acetic acid and its acyl glucuronide by human intestinal Caco-2 cells. Eur J Pharm Sci. 2005 Apr;24(5):513-24. doi: 10.1016/j.ejps.2005.01.006.
• [86] Hepatic transport of PKI166, an epidermal growth factor receptor kinase inhibitor of the pyrrolo-pyrimidine class, and its main metabolite, ACU154. Drug Metab Dispos. 2004 Nov;32(11):1272-8. doi: 10.1124/dmd.104.000497. Epub 2004 Jul 27.
• [87] Human MRP2 exports MC-LR but not the glutathione conjugate. Chem Biol Interact. 2019 Sep 25;311:108761. doi: 10.1016/j.cbi.2019.108761. Epub 2019 Jul 23.
• [88] Directional trans-epithelial transport of organic anions in porcine LLC-PK1 cells that co-express human OATP1B1 (OATP-C) and MRP2. Biochem Pharmacol. 2005 Feb 1;69(3):415-23.
• [89] Molecular mechanisms governing different pharmacokinetics of ginsenosides and potential for ginsenoside-perpetrated herb-drug interactions on OATP1B3. Br J Pharmacol. 2015 Feb;172(4):1059-73. doi: 10.1111/bph.12971. Epub 2015 Jan 20.
• [90] ATP-binding cassette transporters as pitfalls in selection of transgenic cells. Anal Biochem. 2010 Apr 15;399(2):246-50. doi: 10.1016/j.ab.2009.12.014. Epub 2009 Dec 14.
• [91] Mutation of Trp1254 in the multispecific organic anion transporter, multidrug resistance protein 2 (MRP2) (ABCC2), alters substrate specificity and results in loss of methotrexate transport activity. J Biol Chem. 2001 Oct 12;276(41):38108-14. doi: 10.1074/jbc.M105160200. Epub 2001 Aug 10.
• [92] Identification and functional analysis of two novel mutations in the multidrug resistance protein 2 gene in Israeli patients with Dubin-Johnson syndrome. J Biol Chem. 2001 Oct 5;276(40):36923-30. doi: 10.1074/jbc.M105047200. Epub 2001 Jul 26.