Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMAOAP3)

• DOT Name: Transmembrane protease serine 13 (TMPRSS13)
• Synonyms: EC 3.4.21.-; Membrane-type mosaic serine protease; Mosaic serine protease
• Gene Name: TMPRSS13
• Related Disease:
  Anxiety
  Anxiety disorder
  Esophageal squamous cell carcinoma
  Intellectual disability
  Thyroid gland papillary carcinoma
  Advanced cancer
  Amyotrophic lateral sclerosis
  Astrocytoma
  Benign prostatic hyperplasia
  Bipolar disorder
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Carcinoma
  Clear cell renal carcinoma
  Colorectal carcinoma
  Dilated cardiomyopathy 1A
  Ductal breast carcinoma in situ
  Endometriosis
  Familial amyotrophic lateral sclerosis
  Gastric cancer
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Invasive ductal breast carcinoma
  Liver cirrhosis
  Lung cancer
  Lung carcinoma
  Neoplasm
  Pancreatic cancer
  Periodontitis
  Prostate neoplasm
  Schizophrenia
  Small-cell lung cancer
  Stomach cancer
  Bone osteosarcoma
  Melanoma
  Osteosarcoma
  Plasmodium falciparum malaria
  Prostate carcinoma
  Squamous cell carcinoma
  Rheumatoid arthritis
  Adenocarcinoma
  Adult glioblastoma
  Nasopharyngeal carcinoma
  Non-small-cell lung cancer
  Prostate cancer
  Renal cell carcinoma
• UniProt ID: TMPSD_HUMAN
• EC Number: 3.4.21.-
• Pfam ID: PF15494 ; PF00089
• Sequence:
  MERDSHGNASPARTPSAGASPAQASPAGTPPGRASPAQASPAQASPAGTPPGRASPAQAS
  PAGTPPGRASPGRASPAQASPAQASPARASPALASLSRSSSGRSSSARSASVTTSPTRVY
  LVRATPVGAVPIRSSPARSAPATRATRESPGTSLPKFTWREGQKQLPLIGCVLLLIALVV
  SLIILFQFWQGHTGIRYKEQRESCPKHAVRCDGVVDCKLKSDELGCVRFDWDKSLLKIYS
  GSSHQWLPICSSNWNDSYSEKTCQQLGFESAHRTTEVAHRDFANSFSILRYNSTIQESLH
  RSECPSQRYISLQCSHCGLRAMTGRIVGGALASDSKWPWQVSLHFGTTHICGGTLIDAQW
  VLTAAHCFFVTREKVLEGWKVYAGTSNLHQLPEAASIAEIIINSNYTDEEDDYDIALMRL
  SKPLTLSAHIHPACLPMHGQTFSLNETCWITGFGKTRETDDKTSPFLREVQVNLIDFKKC
  NDYLVYDSYLTPRMMCAGDLRGGRDSCQGDSGGPLVCEQNNRWYLAGVTSWGTGCGQRNK
  PGVYTKVTEVLPWIYSKMEVRSLQQDTAPSRLGTSSGGDPGGAPRL
• Function: Serine protease. Cleaves the proform of PRSS8/prostasin to form the active protein. Cleaves the proform of HGF to form the active protein which promotes MAPK signaling. Promotes the formation of the stratum corneum and subsequently the epidermal barrier in embryos.
• Tissue Specificity: Expressed in placenta.; [Isoform 1]: Predominantly expressed in lung, placenta, pancreas, and prostate.; [Isoform 3]: Expressed in lung, placenta, pancreas, and prostate . Weakly expressed in testis and peripheral blood lymphocytes .

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Anxiety	DISIJDBA	Definitive	Biomarker	[1]
Anxiety disorder	DISBI2BT	Definitive	Biomarker	[1]
Esophageal squamous cell carcinoma	DIS5N2GV	Definitive	Biomarker	[2]
Intellectual disability	DISMBNXP	Definitive	Biomarker	[1]
Thyroid gland papillary carcinoma	DIS48YMM	Definitive	Posttranslational Modification	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Biomarker	[5]
Astrocytoma	DISL3V18	Strong	Biomarker	[6]
Benign prostatic hyperplasia	DISI3CW2	Strong	Biomarker	[7]
Bipolar disorder	DISAM7J2	Strong	Biomarker	[8]
Breast cancer	DIS7DPX1	Strong	Biomarker	[9]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[9]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[9]
Carcinoma	DISH9F1N	Strong	Posttranslational Modification	[10]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[12]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Biomarker	[13]
Ductal breast carcinoma in situ	DISLCJY7	Strong	Genetic Variation	[14]
Endometriosis	DISX1AG8	Strong	Biomarker	[15]
Familial amyotrophic lateral sclerosis	DISWZ9CJ	Strong	Genetic Variation	[16]
Gastric cancer	DISXGOUK	Strong	Posttranslational Modification	[17]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Posttranslational Modification	[18]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[19]
Invasive ductal breast carcinoma	DIS43J58	Strong	Biomarker	[13]
Liver cirrhosis	DIS4G1GX	Strong	Biomarker	[20]
Lung cancer	DISCM4YA	Strong	Posttranslational Modification	[21]
Lung carcinoma	DISTR26C	Strong	Posttranslational Modification	[21]
Neoplasm	DISZKGEW	Strong	Posttranslational Modification	[22]
Pancreatic cancer	DISJC981	Strong	Posttranslational Modification	[23]
Periodontitis	DISI9JOI	Strong	Biomarker	[24]
Prostate neoplasm	DISHDKGQ	Strong	Posttranslational Modification	[25]
Schizophrenia	DISSRV2N	Strong	Biomarker	[8]
Small-cell lung cancer	DISK3LZD	Strong	Altered Expression	[26]
Stomach cancer	DISKIJSX	Strong	Posttranslational Modification	[17]
Bone osteosarcoma	DIST1004	moderate	Biomarker	[27]
Melanoma	DIS1RRCY	moderate	Biomarker	[28]
Osteosarcoma	DISLQ7E2	moderate	Biomarker	[27]
Plasmodium falciparum malaria	DIS3Q9KF	moderate	Biomarker	[29]
Prostate carcinoma	DISMJPLE	moderate	Biomarker	[30]
Squamous cell carcinoma	DISQVIFL	moderate	Biomarker	[31]
Rheumatoid arthritis	DISTSB4J	Disputed	Altered Expression	[32]
Adenocarcinoma	DIS3IHTY	Limited	Posttranslational Modification	[33]
Adult glioblastoma	DISVP4LU	Limited	Posttranslational Modification	[34]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Posttranslational Modification	[35]
Non-small-cell lung cancer	DIS5Y6R9	Limited	Biomarker	[36]
Prostate cancer	DISF190Y	Limited	Biomarker	[30]
Renal cell carcinoma	DISQZ2X8	Limited	Posttranslational Modification	[37]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Transmembrane protease serine 13 (TMPRSS13).	[38]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Transmembrane protease serine 13 (TMPRSS13).	[39]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Transmembrane protease serine 13 (TMPRSS13).	[40]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Transmembrane protease serine 13 (TMPRSS13).	[41]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Transmembrane protease serine 13 (TMPRSS13).	[43]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Transmembrane protease serine 13 (TMPRSS13).	[45]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Transmembrane protease serine 13 (TMPRSS13).	[42]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Transmembrane protease serine 13 (TMPRSS13).	[44]

References

• [1] Pharmacotherapy for mood and anxiety disorders in older people with intellectual disability in comparison with the general population.BMC Psychiatry. 2019 Aug 1;19(1):238. doi: 10.1186/s12888-019-2191-7.
• [2] MSH2 promoter hypermethylation in circulating tumor DNA is a valuable predictor of disease-free survival for patients with esophageal squamous cell carcinoma.Eur J Surg Oncol. 2012 Apr;38(4):326-32. doi: 10.1016/j.ejso.2012.01.008. Epub 2012 Jan 23.
• [3] Aberrant hypermethylation of the HOXD10 gene in papillary thyroid cancer with BRAFV600E mutation.Oncol Rep. 2018 Jan;39(1):338-348. doi: 10.3892/or.2017.6058. Epub 2017 Oct 25.
• [4] Inhibition of MSP-RON signaling pathway in cancer cells by a novel soluble form of RON comprising the entire sema sequence.Int J Oncol. 2010 Jun;36(6):1551-61. doi: 10.3892/ijo_00000642.
• [5] VAMP associated proteins are required for autophagic and lysosomal degradation by promoting a PtdIns4P-mediated endosomal pathway.Autophagy. 2019 Jul;15(7):1214-1233. doi: 10.1080/15548627.2019.1580103. Epub 2019 Feb 20.
• [6] Detection of methylation in promoter sequences by melting curve analysis-based semiquantitative real time PCR.BMC Cancer. 2008 Feb 25;8:61. doi: 10.1186/1471-2407-8-61.
• [7] SFRP1 repression in prostate cancer is triggered by two different epigenetic mechanisms.Gene. 2016 Nov 30;593(2):292-301. doi: 10.1016/j.gene.2016.08.030. Epub 2016 Aug 26.
• [8] Comparative linkage meta-analysis reveals regionally-distinct, disparate genetic architectures: application to bipolar disorder and schizophrenia.PLoS One. 2011 Apr 29;6(4):e19073. doi: 10.1371/journal.pone.0019073.
• [9] ESR1 Methylation: A Liquid Biopsy-Based Epigenetic Assay for the Follow-up of Patients with Metastatic Breast Cancer Receiving Endocrine Treatment.Clin Cancer Res. 2018 Mar 15;24(6):1500-1510. doi: 10.1158/1078-0432.CCR-17-1181. Epub 2017 Dec 28.
• [10] Genome-wide methylation profiling identifies hypermethylated biomarkers in high-grade cervical intraepithelial neoplasia.Epigenetics. 2012 Nov;7(11):1268-78. doi: 10.4161/epi.22301. Epub 2012 Sep 27.
• [11] Methylation of the gamma-catenin gene is associated with poor prognosis of renal cell carcinoma.Clin Cancer Res. 2005 Jan 15;11(2 Pt 1):557-64.
• [12] Epigenetic silencing of ADAMTS5 is associated with increased invasiveness and poor survival in patients with colorectal cancer.J Cancer Res Clin Oncol. 2018 Feb;144(2):215-227. doi: 10.1007/s00432-017-2545-9. Epub 2017 Nov 15.
• [13] Pharmacologic reversion of epigenetic silencing of the PRKD1 promoter blocks breast tumor cell invasion and metastasis.Breast Cancer Res. 2013 Aug 23;15(2):R66. doi: 10.1186/bcr3460.
• [14] Differences in Breast Cancer Characteristics by Mammography Screening Participation or Non-Participation.Dtsch Arztebl Int. 2018 Aug 6;115(31-32):520-527. doi: 10.3238/arztebl.2018.0520.
• [15] The macrophage stimulating protein/RON system: a potential novel target for prevention and treatment of endometriosis.Mol Hum Reprod. 2005 May;11(5):345-9. doi: 10.1093/molehr/gah162. Epub 2005 Mar 11.
• [16] Structural, stability, dynamic and binding properties of the ALS-causing T46I mutant of the hVAPB MSP domain as revealed by NMR and MD simulations.PLoS One. 2011;6(11):e27072. doi: 10.1371/journal.pone.0027072. Epub 2011 Nov 1.
• [17] DNA diagnosis of peritoneal fluid cytology test by CDO1 promoter DNA hypermethylation in gastric cancer.Gastric Cancer. 2017 Sep;20(5):784-792. doi: 10.1007/s10120-017-0697-6. Epub 2017 Feb 27.
• [18] Dysregulated miR-363 affects head and neck cancer invasion and metastasis by targeting podoplanin.Int J Biochem Cell Biol. 2013 Mar;45(3):513-20. doi: 10.1016/j.biocel.2012.12.004. Epub 2012 Dec 12.
• [19] Frequent methylation of HOXA9 gene in tumor tissues and plasma samples from human hepatocellular carcinomas.Clin Chem Lab Med. 2014 Aug;52(8):1235-45. doi: 10.1515/cclm-2013-0780.
• [20] Quantitative evaluation of RASSF1A methylation in the non-lesional, regenerative and neoplastic liver.BMC Cancer. 2006 Apr 10;6:89. doi: 10.1186/1471-2407-6-89.
• [21] Abnormal hypermethylation and clinicopathological significance of Axin gene in lung cancer.Tumour Biol. 2013 Apr;34(2):749-57. doi: 10.1007/s13277-012-0604-z. Epub 2012 Nov 29.
• [22] RASSF1A promoter methylation in high-grade serous ovarian cancer: A direct comparison study in primary tumors, adjacent morphologically tumor cell-free tissues and paired circulating tumor DNA.Oncotarget. 2017 Mar 28;8(13):21429-21443. doi: 10.18632/oncotarget.15249.
• [23] Expression of DNMT1 and DNMT3a are regulated by GLI1 in human pancreatic cancer.PLoS One. 2011;6(11):e27684. doi: 10.1371/journal.pone.0027684. Epub 2011 Nov 14.
• [24] Relationship between severity of periodontitis and masseter muscle activity during waking and sleeping hours.Arch Oral Biol. 2018 Jun;90:13-18. doi: 10.1016/j.archoralbio.2018.02.021. Epub 2018 Mar 1.
• [25] DNA-based detection of prostate cancer in blood, urine, and ejaculates.Ann N Y Acad Sci. 2001 Sep;945:51-8. doi: 10.1111/j.1749-6632.2001.tb03863.x.
• [26] Differential screening of a human chromosome 3 library identifies hepatocyte growth factor-like/macrophage-stimulating protein and its receptor in injured lung. Possible implications for neuroendocrine cell survival.J Clin Invest. 1997 Jun 15;99(12):2979-91. doi: 10.1172/JCI119493.
• [27] MSP-4, an antimicrobial peptide, induces apoptosis via activation of extrinsic Fas/FasL- and intrinsic mitochondria-mediated pathways in one osteosarcoma cell line. Mar Drugs. 2018 Jan 2;16(1).
• [28] Comprehensive analysis of receptor tyrosine kinase activation in human melanomas reveals autocrine signaling through IGF-1R.Melanoma Res. 2011 Aug;21(4):274-84. doi: 10.1097/CMR.0b013e328343a1d6.
• [29] Variant-specific antibodies to merozoite surface protein 2 and clinical expression of Plasmodium falciparum malaria in rural Amazonians.Am J Trop Med Hyg. 2007 Jun;76(6):1084-91.
• [30] An exome-wide rare variant analysis of Korean men identifies three novel genes predisposing to prostate cancer.Sci Rep. 2019 Nov 20;9(1):17173. doi: 10.1038/s41598-019-53445-2.
• [31] Cell surface marker profiling of human tracheal basal cells reveals distinct subpopulations, identifies MST1/MSP as a mitogenic signal, and identifies new biomarkers for lung squamous cell carcinomas.Respir Res. 2014 Dec 31;15(1):160. doi: 10.1186/s12931-014-0160-8.
• [32] Identification of pathogenic genes related to rheumatoid arthritis through integrated analysis of DNA methylation and gene expression profiling.Gene. 2017 Nov 15;634:62-67. doi: 10.1016/j.gene.2017.08.032. Epub 2017 Sep 4.
• [33] MAL promoter hypermethylation as a novel prognostic marker in gastric cancer.Br J Cancer. 2008 Dec 2;99(11):1802-7. doi: 10.1038/sj.bjc.6604777. Epub 2008 Nov 11.
• [34] Real-Time Methylation-Specific Polymerase Chain Reaction for MGMT Promoter Methylation Clinical Testing in Glioblastoma: An Alternative Detection Method for a Heterogeneous Process.Am J Clin Pathol. 2017 Oct 1;148(4):296-307. doi: 10.1093/ajcp/aqx073.
• [35] The new 6q27 tumor suppressor DACT2, frequently silenced by CpG methylation, sensitizes nasopharyngeal cancer cells to paclitaxel and 5-FU toxicity via -catenin/Cdc25c signaling and G2/M arrest.Clin Epigenetics. 2018 Feb 27;10(1):26. doi: 10.1186/s13148-018-0459-2.
• [36] Aberrant DNA methylation profiles of non-small cell lung cancers in a Korean population.Lung Cancer. 2007 Oct;58(1):1-6. doi: 10.1016/j.lungcan.2007.04.008. Epub 2007 May 25.
• [37] The Silencing of CCND2 by Promoter Aberrant Methylation in Renal Cell Cancer and Analysis of the Correlation between CCND2 Methylation Status and Clinical Features.PLoS One. 2016 Sep 1;11(9):e0161859. doi: 10.1371/journal.pone.0161859. eCollection 2016.
• [38] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [39] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [40] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [41] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [42] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [43] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [44] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [45] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.