Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNWJWSD)

DOT Name NF-kappa-B essential modulator (IKBKG)
Synonyms
NEMO; FIP-3; IkB kinase-associated protein 1; IKKAP1; Inhibitor of nuclear factor kappa-B kinase subunit gamma; I-kappa-B kinase subunit gamma; IKK-gamma; IKKG; IkB kinase subunit gamma; NF-kappa-B essential modifier
Gene Name IKBKG
Related Disease
Anhidrotic ectodermal dysplasia-immunodeficiency-osteopetrosis-lymphedema syndrome ( )
Carcinoma of liver and intrahepatic biliary tract ( )
Cholangiocarcinoma ( )
Ectodermal dysplasia and immunodeficiency 1 ( )
IKBKG-related immunodeficiency with or without ectodermal dysplasia ( )
Immunodeficiency 33 ( )
Incontinentia pigmenti ( )
Liver cancer ( )
Obsolete immunodeficiency without anhidrotic ectodermal dysplasia ( )
Anemia, nonspherocytic hemolytic, due to G6PD deficiency ( )
Anhidrosis ( )
Autoimmune disease ( )
Bacterial infection ( )
Breast carcinoma ( )
Cardiac failure ( )
Colitis ( )
Congestive heart failure ( )
Ectodermal dysplasia ( )
Fatty liver disease ( )
Hepatitis B virus infection ( )
Herpes simplex infection ( )
Hyper-IgM syndrome type 1 ( )
Immunodeficiency ( )
Inborn error of immunity ( )
Irritable bowel syndrome ( )
Leukemia ( )
Lung cancer ( )
Lung neoplasm ( )
Mycobacterium infection ( )
Neoplasm ( )
Non-alcoholic fatty liver disease ( )
Non-alcoholic steatohepatitis ( )
Osteopetrosis ( )
Pneumonia ( )
Pneumonitis ( )
Tooth agenesis ( )
Vascular disease ( )
X-linked hypohidrotic ectodermal dysplasia ( )
Chronic obstructive pulmonary disease ( )
Plasma cell myeloma ( )
Ectodermal dysplasia and immune deficiency ( )
Myelodysplastic syndrome ( )
Nephritis ( )
Acute myelogenous leukaemia ( )
Advanced cancer ( )
Behcet disease ( )
Breast cancer ( )
Herpes simplex encephalitis ( )
Inflammatory bowel disease ( )
Melanoma ( )
Pancreatic ductal carcinoma ( )
Systemic sclerosis ( )
UniProt ID
NEMO_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2JVX; 2JVY; 3BRT; 3BRV; 3CL3; 3FX0; 4BWN; 5AAY; 5LDE; 6MI3; 6MI4; 6XX0; 6YEK; 7T2U; 7TV4
Pfam ID
PF16516 ; PF11577 ; PF18414
Sequence
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE
LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ
ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH
VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Function
Regulatory subunit of the IKK core complex which phosphorylates inhibitors of NF-kappa-B thus leading to the dissociation of the inhibitor/NF-kappa-B complex and ultimately the degradation of the inhibitor. Its binding to scaffolding polyubiquitin plays a key role in IKK activation by multiple signaling receptor pathways. Can recognize and bind both 'Lys-63'-linked and linear polyubiquitin upon cell stimulation, with a much higher affinity for linear polyubiquitin. Could be implicated in NF-kappa-B-mediated protection from cytokine toxicity. Essential for viral activation of IRF3. Involved in TLR3- and IFIH1-mediated antiviral innate response; this function requires 'Lys-27'-linked polyubiquitination ; (Microbial infection) Also considered to be a mediator for HTLV-1 Tax oncoprotein activation of NF-kappa-B.
Tissue Specificity Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
KEGG Pathway
Antifolate resistance (hsa01523 )
MAPK sig.ling pathway (hsa04010 )
Ras sig.ling pathway (hsa04014 )
Chemokine sig.ling pathway (hsa04062 )
NF-kappa B sig.ling pathway (hsa04064 )
PI3K-Akt sig.ling pathway (hsa04151 )
Apoptosis (hsa04210 )
Osteoclast differentiation (hsa04380 )
Toll-like receptor sig.ling pathway (hsa04620 )
NOD-like receptor sig.ling pathway (hsa04621 )
RIG-I-like receptor sig.ling pathway (hsa04622 )
Cytosolic D.-sensing pathway (hsa04623 )
C-type lectin receptor sig.ling pathway (hsa04625 )
IL-17 sig.ling pathway (hsa04657 )
Th1 and Th2 cell differentiation (hsa04658 )
Th17 cell differentiation (hsa04659 )
T cell receptor sig.ling pathway (hsa04660 )
B cell receptor sig.ling pathway (hsa04662 )
TNF sig.ling pathway (hsa04668 )
Adipocytokine sig.ling pathway (hsa04920 )
Alcoholic liver disease (hsa04936 )
Alzheimer disease (hsa05010 )
Epithelial cell sig.ling in Helicobacter pylori infection (hsa05120 )
Pathogenic Escherichia coli infection (hsa05130 )
Shigellosis (hsa05131 )
Salmonella infection (hsa05132 )
Yersinia infection (hsa05135 )
Chagas disease (hsa05142 )
Toxoplasmosis (hsa05145 )
Hepatitis C (hsa05160 )
Hepatitis B (hsa05161 )
Measles (hsa05162 )
Human cytomegalovirus infection (hsa05163 )
Influenza A (hsa05164 )
Human papillomavirus infection (hsa05165 )
Human T-cell leukemia virus 1 infection (hsa05166 )
Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
Herpes simplex virus 1 infection (hsa05168 )
Epstein-Barr virus infection (hsa05169 )
Human immunodeficiency virus 1 infection (hsa05170 )
Coro.virus disease - COVID-19 (hsa05171 )
Pathways in cancer (hsa05200 )
Viral carcinogenesis (hsa05203 )
Chemical carcinogenesis - reactive oxygen species (hsa05208 )
Pancreatic cancer (hsa05212 )
Prostate cancer (hsa05215 )
Chronic myeloid leukemia (hsa05220 )
Acute myeloid leukemia (hsa05221 )
Small cell lung cancer (hsa05222 )
PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 )
Primary immunodeficiency (hsa05340 )
Lipid and atherosclerosis (hsa05417 )
Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway
ER-Phagosome pathway (R-HSA-1236974 )
NOD1/2 Signaling Pathway (R-HSA-168638 )
TICAM1, RIP1-mediated IKK complex recruitment (R-HSA-168927 )
RIP-mediated NFkB activation via ZBP1 (R-HSA-1810476 )
Downstream TCR signaling (R-HSA-202424 )
FCERI mediated NF-kB activation (R-HSA-2871837 )
TAK1-dependent IKK and NF-kappa-B activation (R-HSA-445989 )
activated TAK1 mediates p38 MAPK activation (R-HSA-450302 )
JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 (R-HSA-450321 )
SUMOylation of immune response proteins (R-HSA-4755510 )
Regulation of TNFR1 signaling (R-HSA-5357905 )
TNFR1-induced NF-kappa-B signaling pathway (R-HSA-5357956 )
IKBKB deficiency causes SCID (R-HSA-5602636 )
IKBKG deficiency causes anhidrotic ectodermal dysplasia with immunodeficiency (EDA-ID) (via TLR) (R-HSA-5603027 )
IkBA variant leads to EDA-ID (R-HSA-5603029 )
CLEC7A (Dectin-1) signaling (R-HSA-5607764 )
MAP3K8 (TPL2)-dependent MAPK1/3 activation (R-HSA-5684264 )
Ub-specific processing proteases (R-HSA-5689880 )
Ovarian tumor domain proteases (R-HSA-5689896 )
Interleukin-1 signaling (R-HSA-9020702 )
TRAF6 mediated NF-kB activation (R-HSA-933542 )
NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10 (R-HSA-933543 )
IRAK1 recruits IKK complex (R-HSA-937039 )
IKK complex recruitment mediated by RIP1 (R-HSA-937041 )
SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671 )
IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation (R-HSA-975144 )
Regulation of NF-kappa B signaling (R-HSA-9758274 )
PKR-mediated signaling (R-HSA-9833482 )
Activation of NF-kappaB in B cells (R-HSA-1169091 )

Molecular Interaction Atlas (MIA) of This DOT

52 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Anhidrotic ectodermal dysplasia-immunodeficiency-osteopetrosis-lymphedema syndrome DISTTB4V Definitive X-linked recessive [1]
Carcinoma of liver and intrahepatic biliary tract DIS8WA0W Definitive Altered Expression [2]
Cholangiocarcinoma DIS71F6X Definitive Genetic Variation [3]
Ectodermal dysplasia and immunodeficiency 1 DISSJX0U Definitive X-linked [4]
IKBKG-related immunodeficiency with or without ectodermal dysplasia DISBPHHV Definitive X-linked [5]
Immunodeficiency 33 DISZWFUU Definitive X-linked recessive [6]
Incontinentia pigmenti DIS0ALLE Definitive X-linked [5]
Liver cancer DISDE4BI Definitive Altered Expression [2]
Obsolete immunodeficiency without anhidrotic ectodermal dysplasia DISNJEZP Definitive X-linked recessive [7]
Anemia, nonspherocytic hemolytic, due to G6PD deficiency DISYJ2T2 Strong CausalMutation [8]
Anhidrosis DISYLSTC Strong Genetic Variation [9]
Autoimmune disease DISORMTM Strong Biomarker [10]
Bacterial infection DIS5QJ9S Strong Biomarker [11]
Breast carcinoma DIS2UE88 Strong Altered Expression [12]
Cardiac failure DISDC067 Strong Altered Expression [13]
Colitis DISAF7DD Strong Biomarker [14]
Congestive heart failure DIS32MEA Strong Altered Expression [13]
Ectodermal dysplasia DISLRS4M Strong Genetic Variation [15]
Fatty liver disease DIS485QZ Strong Biomarker [16]
Hepatitis B virus infection DISLQ2XY Strong Biomarker [17]
Herpes simplex infection DISL1SAV Strong Biomarker [18]
Hyper-IgM syndrome type 1 DISC91LV Strong Genetic Variation [19]
Immunodeficiency DIS093I0 Strong Genetic Variation [20]
Inborn error of immunity DISNGCMN Strong Genetic Variation [21]
Irritable bowel syndrome DIS27206 Strong Therapeutic [22]
Leukemia DISNAKFL Strong Genetic Variation [23]
Lung cancer DISCM4YA Strong Biomarker [24]
Lung neoplasm DISVARNB Strong Biomarker [24]
Mycobacterium infection DISNSMUD Strong Genetic Variation [25]
Neoplasm DISZKGEW Strong Genetic Variation [3]
Non-alcoholic fatty liver disease DISDG1NL Strong Biomarker [26]
Non-alcoholic steatohepatitis DIST4788 Strong Biomarker [26]
Osteopetrosis DIS7GHNM Strong Genetic Variation [27]
Pneumonia DIS8EF3M Strong Biomarker [28]
Pneumonitis DIS88E0K Strong Biomarker [28]
Tooth agenesis DIS1PWC7 Strong Biomarker [29]
Vascular disease DISVS67S Strong Biomarker [30]
X-linked hypohidrotic ectodermal dysplasia DISST0XM Strong Genetic Variation [31]
Chronic obstructive pulmonary disease DISQCIRF moderate Biomarker [32]
Plasma cell myeloma DIS0DFZ0 moderate Biomarker [33]
Ectodermal dysplasia and immune deficiency DISLMZXR Supportive Autosomal dominant [34]
Myelodysplastic syndrome DISYHNUI Disputed Biomarker [35]
Nephritis DISQZQ70 Disputed Biomarker [36]
Acute myelogenous leukaemia DISCSPTN Limited Altered Expression [35]
Advanced cancer DISAT1Z9 Limited Biomarker [37]
Behcet disease DISSYMBS Limited Genetic Variation [14]
Breast cancer DIS7DPX1 Limited Altered Expression [12]
Herpes simplex encephalitis DISGX28I Limited Biomarker [38]
Inflammatory bowel disease DISGN23E Limited Genetic Variation [39]
Melanoma DIS1RRCY Limited Genetic Variation [40]
Pancreatic ductal carcinoma DIS26F9Q Limited Biomarker [41]
Systemic sclerosis DISF44L6 Limited Altered Expression [42]
------------------------------------------------------------------------------------
⏷ Show the Full List of 52 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of NF-kappa-B essential modulator (IKBKG). [43]
Doxorubicin DMVP5YE Approved Doxorubicin increases the phosphorylation of NF-kappa-B essential modulator (IKBKG). [46]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of NF-kappa-B essential modulator (IKBKG). [61]
------------------------------------------------------------------------------------
19 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of NF-kappa-B essential modulator (IKBKG). [44]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of NF-kappa-B essential modulator (IKBKG). [45]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of NF-kappa-B essential modulator (IKBKG). [47]
Estradiol DMUNTE3 Approved Estradiol increases the expression of NF-kappa-B essential modulator (IKBKG). [48]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of NF-kappa-B essential modulator (IKBKG). [49]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of NF-kappa-B essential modulator (IKBKG). [50]
Vorinostat DMWMPD4 Approved Vorinostat decreases the activity of NF-kappa-B essential modulator (IKBKG). [52]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of NF-kappa-B essential modulator (IKBKG). [53]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of NF-kappa-B essential modulator (IKBKG). [54]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of NF-kappa-B essential modulator (IKBKG). [53]
DTI-015 DMXZRW0 Approved DTI-015 decreases the expression of NF-kappa-B essential modulator (IKBKG). [56]
Menthol DMG2KW7 Approved Menthol decreases the expression of NF-kappa-B essential modulator (IKBKG). [57]
Diphenylpyraline DMW4X37 Approved Diphenylpyraline increases the expression of NF-kappa-B essential modulator (IKBKG). [58]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of NF-kappa-B essential modulator (IKBKG). [59]
Chlorpromazine DMBGZI3 Phase 3 Trial Chlorpromazine increases the expression of NF-kappa-B essential modulator (IKBKG). [60]
Chloroquine DMSI5CB Phase 3 Trial Chloroquine decreases the expression of NF-kappa-B essential modulator (IKBKG). [55]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of NF-kappa-B essential modulator (IKBKG). [62]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of NF-kappa-B essential modulator (IKBKG). [63]
Paraquat DMR8O3X Investigative Paraquat increases the expression of NF-kappa-B essential modulator (IKBKG). [64]
------------------------------------------------------------------------------------
⏷ Show the Full List of 19 Drug(s)
2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the localization of NF-kappa-B essential modulator (IKBKG). [51]
Niclosamide DMJAGXQ Approved Niclosamide affects the localization of NF-kappa-B essential modulator (IKBKG). [55]
------------------------------------------------------------------------------------

References

1 Flexible and scalable diagnostic filtering of genomic variants using G2P with Ensembl VEP. Nat Commun. 2019 May 30;10(1):2373. doi: 10.1038/s41467-019-10016-3.
2 CRISPR/Cas9-based editing of a sensitive transcriptional regulatory element to achieve cell type-specific knockdown of the NEMO scaffold protein.PLoS One. 2019 Sep 25;14(9):e0222588. doi: 10.1371/journal.pone.0222588. eCollection 2019.
3 Block of NF-kB signaling accelerates MYC-driven hepatocellular carcinogenesis and modifies the tumor phenotype towards combined hepatocellular cholangiocarcinoma.Cancer Lett. 2019 Aug 28;458:113-122. doi: 10.1016/j.canlet.2019.05.023. Epub 2019 May 22.
4 A novel X-linked disorder of immune deficiency and hypohidrotic ectodermal dysplasia is allelic to incontinentia pigmenti and due to mutations in IKK-gamma (NEMO). Am J Hum Genet. 2000 Dec;67(6):1555-62. doi: 10.1086/316914. Epub 2000 Oct 24.
5 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
6 X-linked susceptibility to mycobacteria is caused by mutations in NEMO impairing CD40-dependent IL-12 production. J Exp Med. 2006 Jul 10;203(7):1745-59. doi: 10.1084/jem.20060085. Epub 2006 Jul 3.
7 Nuclear factor kappaB essential modulator-deficient child with immunodeficiency yet without anhidrotic ectodermal dysplasia. J Allergy Clin Immunol. 2004 Dec;114(6):1456-62. doi: 10.1016/j.jaci.2004.08.047.
8 Newborn screening of glucose-6-phosphate dehydrogenase deficiency in Guangxi, China: determination of optimal cutoff value to identify heterozygous female neonates.Sci Rep. 2018 Jan 16;8(1):833. doi: 10.1038/s41598-017-17667-6.
9 Recruitment of A20 by the C-terminal domain of NEMO suppresses NF-B activation and autoinflammatory disease.Proc Natl Acad Sci U S A. 2016 Feb 9;113(6):1612-7. doi: 10.1073/pnas.1518163113. Epub 2016 Jan 22.
10 NEMO syndrome (incontinentia pigmenti) and systemic lupus erythematosus: a new disease association.Lupus. 2012 May;21(6):675-81. doi: 10.1177/0961203311433140. Epub 2012 Jan 10.
11 Mitochondrial reactive oxygen species enable proinflammatory signaling through disulfide linkage of NEMO.Sci Signal. 2019 Feb 12;12(568):eaar5926. doi: 10.1126/scisignal.aar5926.
12 NEMO, a Transcriptional Target of Estrogen and Progesterone, Is Linked to Tumor Suppressor PML in Breast Cancer.Cancer Res. 2017 Jul 15;77(14):3802-3813. doi: 10.1158/0008-5472.CAN-16-2794. Epub 2017 May 17.
13 Antioxidant amelioration of dilated cardiomyopathy caused by conditional deletion of NEMO/IKKgamma in cardiomyocytes.Circ Res. 2010 Jan 8;106(1):133-44. doi: 10.1161/CIRCRESAHA.109.202200. Epub 2009 Oct 22.
14 Transplantation from a symptomatic carrier sister restores host defenses but does not prevent colitis in NEMO deficiency.Clin Immunol. 2016 Mar;164:52-6. doi: 10.1016/j.clim.2016.01.010. Epub 2016 Jan 23.
15 Functional Evaluation of an IKBKG Variant Suspected to Cause Immunodeficiency Without Ectodermal Dysplasia.J Clin Immunol. 2017 Nov;37(8):801-810. doi: 10.1007/s10875-017-0448-9. Epub 2017 Oct 10.
16 CXCR6 protects from inflammation and fibrosis in NEMO(LPC-KO) mice.Biochim Biophys Acta Mol Basis Dis. 2019 Feb 1;1865(2):391-402. doi: 10.1016/j.bbadis.2018.11.020. Epub 2018 Nov 24.
17 Hepatitis B e Antigen Inhibits NF-B Activity by Interrupting K63-Linked Ubiquitination of NEMO.J Virol. 2019 Jan 4;93(2):e00667-18. doi: 10.1128/JVI.00667-18. Print 2019 Jan 15.
18 NEMO is a key component of NF-B- and IRF-3-dependent TLR3-mediated immunity to herpes simplex virus.J Allergy Clin Immunol. 2011 Sep;128(3):610-7.e1-4. doi: 10.1016/j.jaci.2011.04.059. Epub 2011 Jul 1.
19 Clinical features and genetic analysis of Taiwanese patients with the hyper IgM syndrome phenotype.Pediatr Infect Dis J. 2013 Sep;32(9):1010-6. doi: 10.1097/INF.0b013e3182936280.
20 Two-sided ubiquitin binding of NF-B essential modulator (NEMO) zinc finger unveiled by a mutation associated with anhidrotic ectodermal dysplasia with immunodeficiency syndrome.J Biol Chem. 2013 Nov 22;288(47):33722-33737. doi: 10.1074/jbc.M113.483305. Epub 2013 Oct 7.
21 Conventional and Single-Molecule Targeted Sequencing Method for Specific Variant Detection in IKBKG while Bypassing the IKBKGP1 Pseudogene.J Mol Diagn. 2018 Mar;20(2):195-202. doi: 10.1016/j.jmoldx.2017.10.005. Epub 2017 Dec 18.
22 Colon-targeted cell-permeable NFB inhibitory peptide is orally active against experimental colitis.Mol Pharm. 2012 May 7;9(5):1310-9. doi: 10.1021/mp200591q. Epub 2012 Mar 27.
23 Incontinentia pigmenti with ultrastructurally disordered leucocytes.J Clin Pathol. 2010 Jul;63(7):657-9. doi: 10.1136/jcp.2009.074203.
24 A comparison of transcriptomic and metabonomic technologies for identifying biomarkers predictive of two-year rodent cancer bioassays.Toxicol Sci. 2007 Mar;96(1):40-6. doi: 10.1093/toxsci/kfl171. Epub 2006 Nov 17.
25 IKBKG (NEMO) 5' Untranslated Splice Mutations Lead to Severe, Chronic Disseminated Mycobacterial Infections.Clin Infect Dis. 2018 Jul 18;67(3):456-459. doi: 10.1093/cid/ciy186.
26 Nor-ursodeoxycholic acid reverses hepatocyte-specific nemo-dependent steatohepatitis.Gut. 2011 Mar;60(3):387-96. doi: 10.1136/gut.2010.223834. Epub 2010 Nov 29.
27 Absence of an osteopetrosis phenotype in IKBKG (NEMO) mutation-positive women: A case-control study.Bone. 2019 Apr;121:243-254. doi: 10.1016/j.bone.2019.01.014. Epub 2019 Jan 16.
28 Development of novel NEMO-binding domain mimetics for inhibiting IKK/NF-B activation.PLoS Biol. 2018 Jun 11;16(6):e2004663. doi: 10.1371/journal.pbio.2004663. eCollection 2018 Jun.
29 Novel missense mutations in the AXIN2 gene associated with non-syndromic oligodontia.Arch Oral Biol. 2014 Mar;59(3):349-53. doi: 10.1016/j.archoralbio.2013.12.009. Epub 2013 Dec 31.
30 Retinal vascular changes of incontinentia pigmenti.Arch Ophthalmol. 1976 May;94(5):743-6. doi: 10.1001/archopht.1976.03910030353001.
31 ORAI1 mutations abolishing store-operated Ca(2+) entry cause anhidrotic ectodermal dysplasia with immunodeficiency.J Allergy Clin Immunol. 2018 Oct;142(4):1297-1310.e11. doi: 10.1016/j.jaci.2017.10.031. Epub 2017 Nov 16.
32 Effects of hypoxia on adipose tissue expression of NFB, IB, IKK and IKAP in patients with chronic obstructive pulmonary disease.Cell Biochem Biophys. 2013 May;66(1):7-12. doi: 10.1007/s12013-012-9391-9.
33 Genomic studies of multiple myeloma reveal an association between X chromosome alterations and genomic profile complexity.Genes Chromosomes Cancer. 2017 Jan;56(1):18-27. doi: 10.1002/gcc.22397. Epub 2016 Aug 18.
34 Clinical Practice Guidelines for Rare Diseases: The Orphanet Database. PLoS One. 2017 Jan 18;12(1):e0170365. doi: 10.1371/journal.pone.0170365. eCollection 2017.
35 ATM mediates constitutive NF-kappaB activation in high-risk myelodysplastic syndrome and acute myeloid leukemia.Oncogene. 2009 Feb 26;28(8):1099-109. doi: 10.1038/onc.2008.457. Epub 2008 Dec 15.
36 T-lymphocyte-specific knockout of IKK-2 or NEMO induces T(h)17 cells in an experimental nephrotoxic nephritis mouse model.FASEB J. 2019 Feb;33(2):2359-2371. doi: 10.1096/fj.201800485RR. Epub 2018 Oct 4.
37 An NF-kappaB- and IKK-Independent Function of NEMO Prevents Hepatocarcinogenesis by Suppressing Compensatory Liver Regeneration.Cancers (Basel). 2019 Jul 17;11(7):999. doi: 10.3390/cancers11070999.
38 Mendelian predisposition to herpes simplex encephalitis.Handb Clin Neurol. 2013;112:1091-7. doi: 10.1016/B978-0-444-52910-7.00027-1.
39 Inflammatory bowel disease caused by primary immunodeficiencies-Clinical presentations, review of literature, and proposal of a rational diagnostic algorithm.Pediatr Allergy Immunol. 2017 Aug;28(5):412-429. doi: 10.1111/pai.12734.
40 MEK inhibition and immune responses in advanced melanoma.Oncoimmunology. 2017 Aug 10;6(8):e1335843. doi: 10.1080/2162402X.2017.1335843. eCollection 2017.
41 NEMO peptide inhibits the growth of pancreatic ductal adenocarcinoma by blocking NF-B activation.Cancer Lett. 2017 Dec 28;411:44-56. doi: 10.1016/j.canlet.2017.09.018. Epub 2017 Sep 23.
42 NEMO score in nailfold videocapillaroscopy is a good tool to assess both steady state levels and overtime changes of disease activity in patients with systemic sclerosis: a comparison with the proposed composite indices for this disease status entity.Arthritis Res Ther. 2019 Nov 29;21(1):258. doi: 10.1186/s13075-019-2032-6.
43 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
44 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
45 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
46 Antagonizing binding of cell cycle and apoptosis regulatory protein 1 (CARP-1) to the NEMO/IKK protein enhances the anticancer effect of chemotherapy. J Biol Chem. 2020 Mar 13;295(11):3532-3552. doi: 10.1074/jbc.RA119.009898. Epub 2020 Feb 4.
47 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
48 Transcriptional responses to estrogen and progesterone in mammary gland identify networks regulating p53 activity. Endocrinology. 2008 Oct;149(10):4809-20. doi: 10.1210/en.2008-0035. Epub 2008 Jun 12.
49 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
50 Arsenic trioxide induces apoptosis in NB-4, an acute promyelocytic leukemia cell line, through up-regulation of p73 via suppression of nuclear factor kappa B-mediated inhibition of p73 transcription and prevention of NF-kappaB-mediated induction of XIAP, cIAP2, BCL-XL and survivin. Med Oncol. 2010 Sep;27(3):833-42. doi: 10.1007/s12032-009-9294-9. Epub 2009 Sep 10.
51 PARP inhibition induces Akt-mediated cytoprotective effects through the formation of a mitochondria-targeted phospho-ATM-NEMO-Akt-mTOR signalosome. Biochem Pharmacol. 2019 Apr;162:98-108. doi: 10.1016/j.bcp.2018.10.005. Epub 2018 Oct 6.
52 Suberoylanilide hydroxamic acid (Zolinza/vorinostat) sensitizes TRAIL-resistant breast cancer cells orthotopically implanted in BALB/c nude mice. Mol Cancer Ther. 2009 Jun;8(6):1596-605. doi: 10.1158/1535-7163.MCT-08-1004. Epub 2009 Jun 9.
53 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
54 Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
55 Niclosamide, an anti-helminthic molecule, downregulates the retroviral oncoprotein Tax and pro-survival Bcl-2 proteins in HTLV-1-transformed T lymphocytes. Biochem Biophys Res Commun. 2015 Aug 14;464(1):221-228. doi: 10.1016/j.bbrc.2015.06.120. Epub 2015 Jun 23.
56 Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
57 Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
58 Controlled diesel exhaust and allergen coexposure modulates microRNA and gene expression in humans: Effects on inflammatory lung markers. J Allergy Clin Immunol. 2016 Dec;138(6):1690-1700. doi: 10.1016/j.jaci.2016.02.038. Epub 2016 Apr 24.
59 Results of a phase I pilot clinical trial examining the effect of plant-derived resveratrol and grape powder on Wnt pathway target gene expression in colonic mucosa and colon cancer. Cancer Manag Res. 2009 Apr 3;1:25-37.
60 Effects of chlorpromazine with and without UV irradiation on gene expression of HepG2 cells. Mutat Res. 2005 Aug 4;575(1-2):47-60. doi: 10.1016/j.mrfmmm.2005.03.002. Epub 2005 Apr 26.
61 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
62 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
63 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
64 CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.