Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTP52YZ3)

DOT Name U1 small nuclear ribonucleoprotein 70 kDa (SNRNP70)
Synonyms U1 snRNP 70 kDa; U1-70K; snRNP70
Gene Name SNRNP70
Related Disease
Glioma ( )
Myocardial infarction ( )
Neoplasm ( )
Spinocerebellar ataxia type 1 ( )
Alcohol dependence ( )
Alzheimer disease ( )
Autism ( )
Autism spectrum disorder ( )
Azoospermia ( )
Bladder cancer ( )
Connective tissue disorder ( )
Coronary atherosclerosis ( )
Hirschsprung disease ( )
Lupus ( )
Mixed connective tissue disease ( )
Myositis disease ( )
Non-insulin dependent diabetes ( )
Obesity ( )
Panic disorder ( )
Parkinson disease ( )
Prostate cancer ( )
Prostate carcinoma ( )
Psoriasis ( )
Sarcoidosis ( )
Systemic sclerosis ( )
Tuberculosis ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Asthma ( )
Diabetic kidney disease ( )
Pemphigus vulgaris ( )
Type-1/2 diabetes ( )
Arrhythmia ( )
Coronary heart disease ( )
Q fever ( )
Systemic lupus erythematosus ( )
UniProt ID
RU17_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2L5I; 2L5J; 3CW1; 3PGW; 4PJO; 4PKD; 6QX9; 7B0Y; 7VPX
Pfam ID
PF00076 ; PF12220
Sequence
MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRA
ETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLR
REFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVER
GRTVKGWRPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDERPGPSPLPHRDRDRDRERE
RRERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRERSKDKDRDRKRRSSRSRERAR
RERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDRDRERRRSHRS
ERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQDNGLEGLGNDSRDMYMESEGG
DGYLAPENGYLMEAAPE
Function
Component of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. SNRNP70 binds to the loop I region of U1-snRNA ; [Isoform 3]: Truncated isoforms that lack the RRM domain cannot bind U1-snRNA; [Isoform 4]: Truncated isoforms that lack the RRM domain cannot bind U1-snRNA.
KEGG Pathway
Spliceosome (hsa03040 )
Reactome Pathway
mRNA Splicing - Major Pathway (R-HSA-72163 )

Molecular Interaction Atlas (MIA) of This DOT

36 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Glioma DIS5RPEH Definitive Genetic Variation [1]
Myocardial infarction DIS655KI Definitive Genetic Variation [2]
Neoplasm DISZKGEW Definitive Genetic Variation [3]
Spinocerebellar ataxia type 1 DISF7BO2 Definitive Genetic Variation [4]
Alcohol dependence DIS4ZSCO Strong Biomarker [5]
Alzheimer disease DISF8S70 Strong Biomarker [6]
Autism DISV4V1Z Strong Genetic Variation [7]
Autism spectrum disorder DISXK8NV Strong Genetic Variation [8]
Azoospermia DIS94181 Strong Biomarker [9]
Bladder cancer DISUHNM0 Strong Genetic Variation [10]
Connective tissue disorder DISKXBS3 Strong Biomarker [11]
Coronary atherosclerosis DISKNDYU Strong Genetic Variation [12]
Hirschsprung disease DISUUSM1 Strong Genetic Variation [13]
Lupus DISOKJWA Strong Biomarker [14]
Mixed connective tissue disease DISXX0H8 Strong Genetic Variation [11]
Myositis disease DISCIXF0 Strong Biomarker [15]
Non-insulin dependent diabetes DISK1O5Z Strong Genetic Variation [16]
Obesity DIS47Y1K Strong Biomarker [17]
Panic disorder DISD3VNY Strong Genetic Variation [18]
Parkinson disease DISQVHKL Strong Biomarker [19]
Prostate cancer DISF190Y Strong Genetic Variation [20]
Prostate carcinoma DISMJPLE Strong Genetic Variation [20]
Psoriasis DIS59VMN Strong Genetic Variation [21]
Sarcoidosis DISE5B8Z Strong Biomarker [22]
Systemic sclerosis DISF44L6 Strong Genetic Variation [11]
Tuberculosis DIS2YIMD Strong Biomarker [23]
Urinary bladder cancer DISDV4T7 Strong Genetic Variation [10]
Urinary bladder neoplasm DIS7HACE Strong Genetic Variation [10]
Asthma DISW9QNS moderate Genetic Variation [24]
Diabetic kidney disease DISJMWEY moderate Biomarker [25]
Pemphigus vulgaris DISENR62 moderate Biomarker [26]
Type-1/2 diabetes DISIUHAP moderate Genetic Variation [27]
Arrhythmia DISFF2NI Limited Biomarker [28]
Coronary heart disease DIS5OIP1 Limited Genetic Variation [12]
Q fever DISK1S90 Limited Genetic Variation [29]
Systemic lupus erythematosus DISI1SZ7 Limited Genetic Variation [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 36 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of U1 small nuclear ribonucleoprotein 70 kDa (SNRNP70). [30]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of U1 small nuclear ribonucleoprotein 70 kDa (SNRNP70). [31]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of U1 small nuclear ribonucleoprotein 70 kDa (SNRNP70). [32]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of U1 small nuclear ribonucleoprotein 70 kDa (SNRNP70). [30]
Decitabine DMQL8XJ Approved Decitabine increases the expression of U1 small nuclear ribonucleoprotein 70 kDa (SNRNP70). [33]
Menadione DMSJDTY Approved Menadione affects the expression of U1 small nuclear ribonucleoprotein 70 kDa (SNRNP70). [34]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of U1 small nuclear ribonucleoprotein 70 kDa (SNRNP70). [35]
Pyrrolidine dithiocarbamate DM5ZAS6 Investigative Pyrrolidine dithiocarbamate increases the expression of U1 small nuclear ribonucleoprotein 70 kDa (SNRNP70). [36]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Tagging SNPs in non-homologous end-joining pathway genes and risk of glioma.Carcinogenesis. 2007 Sep;28(9):1906-13. doi: 10.1093/carcin/bgm073. Epub 2007 Mar 26.
2 Angiotensin II type I receptor gene and myocardial infarction: tagging SNPs and haplotype based association study. The Beijing atherosclerosis study.Pharmacogenetics. 2004 Oct;14(10):673-81. doi: 10.1097/00008571-200410000-00005.
3 An NKX3.1 binding site polymorphism in the l-plastin promoter leads to differential gene expression in human prostate cancer.Int J Cancer. 2016 Jan 1;138(1):74-86. doi: 10.1002/ijc.29677. Epub 2015 Jul 17.
4 Insights into the mutational history and prevalence of SCA1 in the Indian population through anchored polymorphisms.Hum Genet. 2005 Oct;118(1):107-14. doi: 10.1007/s00439-005-0018-8. Epub 2005 Oct 28.
5 Replication of genome wide association studies of alcohol dependence: support for association with variation in ADH1C.PLoS One. 2013;8(3):e58798. doi: 10.1371/journal.pone.0058798. Epub 2013 Mar 13.
6 RNA-binding proteins with basic-acidic dipeptide (BAD) domains self-assemble and aggregate in Alzheimer's disease.J Biol Chem. 2018 Jul 13;293(28):11047-11066. doi: 10.1074/jbc.RA118.001747. Epub 2018 May 25.
7 Glutamate receptor 6 gene (GluR6 or GRIK2) polymorphisms in the Indian population: a genetic association study on autism spectrum disorder.Cell Mol Neurobiol. 2007 Dec;27(8):1035-47. doi: 10.1007/s10571-007-9193-6. Epub 2007 Aug 22.
8 The association analysis of RELN and GRM8 genes with autistic spectrum disorder in Chinese Han population.Am J Med Genet B Neuropsychiatr Genet. 2008 Mar 5;147B(2):194-200. doi: 10.1002/ajmg.b.30584.
9 Single-nucleotide polymorphisms in HORMAD1 may be a risk factor for azoospermia caused by meiotic arrest in Japanese patients.Asian J Androl. 2012 Jul;14(4):580-3. doi: 10.1038/aja.2011.180. Epub 2012 Mar 12.
10 Genetic variants in the death receptor 4 gene contribute to susceptibility to bladder cancer.Mutat Res. 2009 Feb 10;661(1-2):85-92. doi: 10.1016/j.mrfmmm.2008.11.009. Epub 2008 Nov 25.
11 Is the T-G-CT-G SNRNP70 haplotype another proof that mixed connective tissue disease is distinct from systemic lupus erythematosus and systemic sclerosis? A novel gene variant in SNRNP70 gene.Clin Exp Rheumatol. 2019 Jul-Aug;37 Suppl 119(4):32-40. Epub 2019 Sep 17.
12 TIMD4 rs6882076 SNP Is Associated with Decreased Levels of Triglycerides and the Risk of Coronary Heart Disease and Ischemic Stroke.Int J Med Sci. 2019 Jun 2;16(6):864-871. doi: 10.7150/ijms.31729. eCollection 2019.
13 Tissue specific somatic mutations and aganglionosis in Hirschsprung's disease.J Pediatr Surg. 2014 Feb;49(2):258-61; discussion 261. doi: 10.1016/j.jpedsurg.2013.11.035. Epub 2013 Nov 15.
14 U1RNP antibody-positive neonatal lupus. A report of two cases with immunogenetic studies.Arch Dermatol. 1992 Nov;128(11):1490-4.
15 Scurfy Mice Develop Features of Connective Tissue Disease Overlap Syndrome and Mixed Connective Tissue Disease in the Absence of Regulatory T Cells.Front Immunol. 2019 Apr 24;10:881. doi: 10.3389/fimmu.2019.00881. eCollection 2019.
16 11beta-Hydroxysteroid dehydrogenase Type 1: genetic polymorphisms are associated with Type 2 diabetes in Pima Indians independently of obesity and expression in adipocyte and muscle.Diabetologia. 2004 Jun;47(6):1088-95. doi: 10.1007/s00125-004-1407-6. Epub 2004 May 20.
17 FTO rs 9939609 SNP Is Associated With Adiponectin and Leptin Levels and the Risk of Obesity in a Cohort of Romanian Children Population.Medicine (Baltimore). 2016 May;95(20):e3709. doi: 10.1097/MD.0000000000003709.
18 Investigation of polymorphisms in the CREM gene in panic disorder.Am J Med Genet B Neuropsychiatr Genet. 2004 Apr 1;126B(1):111-5. doi: 10.1002/ajmg.b.20121.
19 Transcription factor PITX3 gene in Parkinson's disease.Neurobiol Aging. 2011 Apr;32(4):750-3. doi: 10.1016/j.neurobiolaging.2009.03.015. Epub 2009 Apr 24.
20 Variants of the hK2 protein gene (KLK2) are associated with serum hK2 levels and predict the presence of prostate cancer at biopsy.Clin Cancer Res. 2006 Nov 1;12(21):6452-8. doi: 10.1158/1078-0432.CCR-06-1485.
21 notch2, notch4 gene polymorphisms in psoriasis vulgaris.Eur J Dermatol. 2013 Apr 1;23(2):146-53. doi: 10.1684/ejd.2013.1985.
22 Clinical characteristics of sarcoidosis patients with systemic sclerosis-specific autoantibody: Possible involvement of thymus and activation-regulated chemokine and a review of the published works.J Dermatol. 2019 Jul;46(7):577-583. doi: 10.1111/1346-8138.14932. Epub 2019 May 27.
23 Association between SLC11A1 (NRAMP1) polymorphisms and susceptibility to tuberculosis in Chinese Holstein cattle.Tuberculosis (Edinb). 2017 Mar;103:10-15. doi: 10.1016/j.tube.2016.11.003. Epub 2016 Nov 9.
24 Functional variants in the thromboxane A2 receptor gene are associated with lung function in childhood-onset asthma.Clin Exp Allergy. 2013 Apr;43(4):413-24. doi: 10.1111/cea.12058.
25 Risk genotypes and haplotypes of the GLUT1 gene for type 2 diabetic nephropathy in the Tunisian population.Ann Hum Biol. 2008 Sep-Oct;35(5):490-8. doi: 10.1080/03014460802247142.
26 The molecular basis for the presence of two autoimmune diseases occurring simultaneously--preliminary observations based on computer analysis.Autoimmunity. 2012 May;45(3):253-63. doi: 10.3109/08916934.2011.632454. Epub 2011 Nov 29.
27 Molecular analysis of KCNJ10 on 1q as a candidate gene for Type 2 diabetes in Pima Indians.Diabetes. 2002 Nov;51(11):3342-6. doi: 10.2337/diabetes.51.11.3342.
28 Serological and clinical profile of systemic sclerosis: analysis in a cohort of patients from a single center in Northern Italy.G Ital Dermatol Venereol. 2018 Feb;153(1):33-38. doi: 10.23736/S0392-0488.16.05319-0. Epub 2016 Apr 7.
29 A Q Fever Outbreak with a High Rate of Abortions at a Dairy Goat Farm: Coxiella burnetii Shedding, Environmental Contamination, and Viability.Appl Environ Microbiol. 2018 Oct 1;84(20):e01650-18. doi: 10.1128/AEM.01650-18. Print 2018 Oct 15.
30 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
31 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
32 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
33 Gene induction and apoptosis in human hepatocellular carci-noma cells SMMC-7721 exposed to 5-aza-2'-deoxycytidine. Chin Med J (Engl). 2007 Sep 20;120(18):1626-31.
34 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
35 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
36 Effects of a redox-active agent on lymphocyte activation and early gene expression patterns. Free Radic Biol Med. 2004 Nov 15;37(10):1550-63.