Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQOA4ZH)

• DOT Name: Bone morphogenetic protein receptor type-1A (BMPR1A)
• Synonyms: BMP type-1A receptor; BMPR-1A; EC 2.7.11.30; Activin receptor-like kinase 3; ALK-3; Serine/threonine-protein kinase receptor R5; SKR5; CD antigen CD292
• Gene Name: BMPR1A
• Related Disease:
  Carcinoma of liver and intrahepatic biliary tract
  Gastric cancer
  Generalized juvenile polyposis/juvenile polyposis coli
  Juvenile polyposis syndrome
  Liver cancer
  Metastatic malignant neoplasm
  Acute myelogenous leukaemia
  Advanced cancer
  Atrial septal defect
  Bannayan-Riley-Ruvalcaba syndrome
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cardiac failure
  Colon carcinoma
  Colorectal carcinoma
  Congenital heart disease
  Congestive heart failure
  Coronary heart disease
  Hepatocellular carcinoma
  Hereditary neoplastic syndrome
  High blood pressure
  Neoplasm
  Obesity
  Osteoarthritis
  Polycystic ovarian syndrome
  Polyp of large intestine
  Polyposis
  Polyposis syndrome, hereditary mixed, 1
  Polyposis syndrome, hereditary mixed, 2
  Prostate cancer
  Squamous cell carcinoma
  Stomach cancer
  Cardiovascular disease
  Neuroblastoma
  Plasma cell myeloma
  Prostate carcinoma
  Hereditary mixed polyposis syndrome
  Hyperostosis
  Pulmonary arterial hypertension
  Chronic obstructive pulmonary disease
  Colon cancer
  Colonic neoplasm
  Familial adenomatous polyposis
  Familial colorectal cancer type X
  Polyp
  Thyroid gland papillary carcinoma
• UniProt ID: BMR1A_HUMAN
• PDB ID: 1ES7; 1REW; 2GOO; 2H62; 2H64; 2K3G; 2QJ9; 2QJA; 2QJB; 3NH7; 3QB4
• EC Number: 2.7.11.30
• Pfam ID: PF01064 ; PF00069 ; PF08515
• Sequence:
  MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLK
  CYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRR
  TIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFCYKHYC
  KSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQV
  GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTG
  SWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAH
  RDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKN
  HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLR
  PIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
• Function: On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMP2, BMP4, GDF5 and GDF6. Positively regulates chondrocyte differentiation through GDF5 interaction. Mediates induction of adipogenesis by GDF6. May promote the expression of HAMP, potentially via its interaction with BMP2.
• Tissue Specificity: Highly expressed in skeletal muscle.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  TGF-beta sig.ling pathway (hsa04350)
  Hippo sig.ling pathway (hsa04390)
  Sig.ling pathways regulating pluripotency of stem cells (hsa04550)
  Fluid shear stress and atherosclerosis (hsa05418)
• Reactome Pathway: Signaling by BMP (R-HSA-201451)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Definitive	Altered Expression	[1]
Gastric cancer	DISXGOUK	Definitive	Genetic Variation	[2]
Generalized juvenile polyposis/juvenile polyposis coli	DISWA3FF	Definitive	Autosomal dominant	[3]
Juvenile polyposis syndrome	DISBPSLH	Definitive	Autosomal dominant	[4]
Liver cancer	DISDE4BI	Definitive	Altered Expression	[1]
Metastatic malignant neoplasm	DIS86UK6	Definitive	Biomarker	[5]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[6]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[7]
Atrial septal defect	DISJT76B	Strong	Genetic Variation	[8]
Bannayan-Riley-Ruvalcaba syndrome	DIS99DFP	Strong	Biomarker	[9]
Breast cancer	DIS7DPX1	Strong	Biomarker	[5]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[5]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[10]
Cardiac failure	DISDC067	Strong	Altered Expression	[11]
Colon carcinoma	DISJYKUO	Strong	Genetic Variation	[12]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[13]
Congenital heart disease	DISQBA23	Strong	Genetic Variation	[14]
Congestive heart failure	DIS32MEA	Strong	Altered Expression	[11]
Coronary heart disease	DIS5OIP1	Strong	Biomarker	[11]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[1]
Hereditary neoplastic syndrome	DISGXLG5	Strong	Genetic Variation	[15]
High blood pressure	DISY2OHH	Strong	Altered Expression	[16]
Neoplasm	DISZKGEW	Strong	Biomarker	[5]
Obesity	DIS47Y1K	Strong	Biomarker	[17]
Osteoarthritis	DIS05URM	Strong	Biomarker	[18]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Altered Expression	[19]
Polyp of large intestine	DISRE1MK	Strong	Genetic Variation	[13]
Polyposis	DISZSPOK	Strong	Altered Expression	[20]
Polyposis syndrome, hereditary mixed, 1	DISG6RBU	Strong	GermlineCausalMutation	[21]
Polyposis syndrome, hereditary mixed, 2	DISSRCA0	Strong	Autosomal dominant	[22]
Prostate cancer	DISF190Y	Strong	Genetic Variation	[23]
Squamous cell carcinoma	DISQVIFL	Strong	Genetic Variation	[24]
Stomach cancer	DISKIJSX	Strong	Genetic Variation	[2]
Cardiovascular disease	DIS2IQDX	moderate	Biomarker	[14]
Neuroblastoma	DISVZBI4	moderate	Altered Expression	[25]
Plasma cell myeloma	DIS0DFZ0	moderate	Biomarker	[26]
Prostate carcinoma	DISMJPLE	moderate	Genetic Variation	[23]
Hereditary mixed polyposis syndrome	DISPNBY1	Supportive	Autosomal dominant	[21]
Hyperostosis	DIS60EOE	Disputed	Genetic Variation	[27]
Pulmonary arterial hypertension	DISP8ZX5	Disputed	Unknown	[4]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Altered Expression	[28]
Colon cancer	DISVC52G	Limited	Genetic Variation	[12]
Colonic neoplasm	DISSZ04P	Limited	Genetic Variation	[29]
Familial adenomatous polyposis	DISW53RE	Limited	Genetic Variation	[30]
Familial colorectal cancer type X	DISEBNIA	Limited	Biomarker	[31]
Polyp	DISRSLYF	Limited	Biomarker	[32]
Thyroid gland papillary carcinoma	DIS48YMM	Limited	Genetic Variation	[33]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Bone morphogenetic protein receptor type-1A (BMPR1A).	[34]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Bone morphogenetic protein receptor type-1A (BMPR1A).	[35]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Bone morphogenetic protein receptor type-1A (BMPR1A).	[36]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Bone morphogenetic protein receptor type-1A (BMPR1A).	[38]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Bone morphogenetic protein receptor type-1A (BMPR1A).	[39]
Ardeparin	DMYRX8B	Approved	Ardeparin decreases the expression of Bone morphogenetic protein receptor type-1A (BMPR1A).	[40]
Adenosine	DMM2NSK	Approved	Adenosine increases the expression of Bone morphogenetic protein receptor type-1A (BMPR1A).	[41]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Bone morphogenetic protein receptor type-1A (BMPR1A).	[42]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Bone morphogenetic protein receptor type-1A (BMPR1A).	[46]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of Bone morphogenetic protein receptor type-1A (BMPR1A).	[47]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Bone morphogenetic protein receptor type-1A (BMPR1A).	[48]
Dorsomorphin	DMKYXJW	Investigative	Dorsomorphin decreases the expression of Bone morphogenetic protein receptor type-1A (BMPR1A).	[40]
Apomorphine SL	DMPH7EO	Investigative	Apomorphine SL decreases the expression of Bone morphogenetic protein receptor type-1A (BMPR1A).	[40]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Bone morphogenetic protein receptor type-1A (BMPR1A).	[37]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Bone morphogenetic protein receptor type-1A (BMPR1A).	[43]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Bone morphogenetic protein receptor type-1A (BMPR1A).	[44]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Bone morphogenetic protein receptor type-1A (BMPR1A).	[45]

References

• [1] LncRNA HAND2-AS1 promotes liver cancer stem cell self-renewal via BMP signaling.EMBO J. 2019 Sep 2;38(17):e101110. doi: 10.15252/embj.2018101110. Epub 2019 Jul 23.
• [2] High proportion of large genomic deletions and a genotype phenotype update in 80 unrelated families with juvenile polyposis syndrome.J Med Genet. 2007 Nov;44(11):702-9. doi: 10.1136/jmg.2007.052506. Epub 2007 Sep 14.
• [3] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [4] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [5] Knockdown of Bone Morphogenetic Proteins Type 1a Receptor (BMPR1a) in Breast Cancer Cells Protects Bone from Breast Cancer-Induced Osteolysis by Suppressing RANKL Expression.Cell Physiol Biochem. 2018;45(5):1759-1771. doi: 10.1159/000487784. Epub 2018 Feb 23.
• [6] A new signaling cascade linking BMP4, BMPR1A, Np73 and NANOG impacts on stem-like human cell properties and patient outcome.Cell Death Dis. 2018 Sep 27;9(10):1011. doi: 10.1038/s41419-018-1042-7.
• [7] Exome sequencing in 51 early onset non-familial CRC cases.Mol Genet Genomic Med. 2019 May;7(5):e605. doi: 10.1002/mgg3.605. Epub 2019 Feb 27.
• [8] BMPR1A mutation-positive juvenile polyposis syndrome and atrial septal defect: coincidence or association?.BMJ Case Rep. 2019 Jun 21;12(6):e229881. doi: 10.1136/bcr-2019-229881.
• [9] A new case with 10q23 interstitial deletion encompassing both PTEN and BMPR1A narrows the genetic region deleted in juvenile polyposis syndrome.J Appl Genet. 2013 Feb;54(1):43-7. doi: 10.1007/s13353-012-0115-z. Epub 2012 Sep 21.
• [10] Deletion of the BMP receptor BMPR1a impairs mammary tumor formation and metastasis.Oncotarget. 2015 Sep 8;6(26):22890-904. doi: 10.18632/oncotarget.4413.
• [11] Expression of bone morphogenetic protein 4 and its receptors in the remodeling heart.Life Sci. 2014 Mar 3;97(2):145-54. doi: 10.1016/j.lfs.2013.12.030. Epub 2014 Jan 4.
• [12] Clinical and molecular characterization of individuals with recurrent genomic disorder at 10q22.3q23.2.Clin Genet. 2010 Aug;78(2):162-8. doi: 10.1111/j.1399-0004.2010.01373.x. Epub 2010 Feb 9.
• [13] Co-occurrence of Lynch syndrome and juvenile polyposis syndrome confirmed by multigene panel testing.Fam Cancer. 2018 Jan;17(1):87-90. doi: 10.1007/s10689-017-0012-z.
• [14] A familial congenital heart disease with a possible multigenic origin involving a mutation in BMPR1A.Sci Rep. 2019 Feb 27;9(1):2959. doi: 10.1038/s41598-019-39648-7.
• [15] Assessment of structurally and functionally high-risk nsSNPs impacts on human bone morphogenetic protein receptor type IA (BMPR1A) by computational approach.Comput Biol Chem. 2019 Jun;80:31-45. doi: 10.1016/j.compbiolchem.2019.03.004. Epub 2019 Mar 12.
• [16] Signaling molecules in nonfamilial pulmonary hypertension.N Engl J Med. 2003 Feb 6;348(6):500-9. doi: 10.1056/NEJMoa021650.
• [17] Reestablishment of Energy Balance in a Male Mouse Model With POMC Neuron Deletion of BMPR1A.Endocrinology. 2017 Dec 1;158(12):4233-4245. doi: 10.1210/en.2017-00212.
• [18] Expression of BMP-receptor type 1A correlates with progress of osteoarthritis in human knee joints with focal cartilage lesions.Cytotherapy. 2012 Aug;14(7):868-76. doi: 10.3109/14653249.2012.681039. Epub 2012 Apr 23.
• [19] BMP system expression in GCs from polycystic ovary syndrome women and the in vitro effects of BMP4, BMP6, and BMP7 on GC steroidogenesis.Eur J Endocrinol. 2013 Feb 20;168(3):437-44. doi: 10.1530/EJE-12-0891. Print 2013 Mar.
• [20] Bmp signaling in colonic mesenchyme regulates stromal microenvironment and protects from polyposis initiation.Int J Cancer. 2016 Jun 1;138(11):2700-12. doi: 10.1002/ijc.30001. Epub 2016 Feb 10.
• [21] Mapping of hereditary mixed polyposis syndrome (HMPS) to chromosome 10q23 by genomewide high-density single nucleotide polymorphism (SNP) scan and identification of BMPR1A loss of function. J Med Genet. 2006 Mar;43(3):e13. doi: 10.1136/jmg.2005.034827.
• [22] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [23] PTEN genomic deletions that characterize aggressive prostate cancer originate close to segmental duplications.Genes Chromosomes Cancer. 2012 Feb;51(2):149-60. doi: 10.1002/gcc.20939. Epub 2011 Nov 1.
• [24] Wnt/-catenin signalling induces MLL to create epigenetic changes in salivary gland tumours.EMBO J. 2013 Jul 17;32(14):1977-89. doi: 10.1038/emboj.2013.127. Epub 2013 Jun 4.
• [25] Intact or broken-apart RNA: an alternative concept for ALK fusion screening in non-small cell lung cancer (NSCLC).Appl Immunohistochem Mol Morphol. 2015 Jan;23(1):60-70. doi: 10.1097/PAI.0000000000000028.
• [26] Transcriptomic profiling of the myeloma bone-lining niche reveals BMP signalling inhibition to improve bone disease.Nat Commun. 2019 Oct 4;10(1):4533. doi: 10.1038/s41467-019-12296-1.
• [27] Differential involvement of Wnt signaling in Bmp regulation of cancellous versus periosteal bone growth.Bone Res. 2017 Jun 6;5:17016. doi: 10.1038/boneres.2017.16. eCollection 2017.
• [28] Exaggerated BMP4 signalling alters human airway basal progenitor celldifferentiation to cigarette smoking-related phenotypes.Eur Respir J. 2019 May 18;53(5):1702553. doi: 10.1183/13993003.02553-2017. Print 2019 May.
• [29] A family with two consecutive nonsense mutations in BMPR1A causing juvenile polyposis.Cancer Genet Cytogenet. 2008 Feb;181(1):52-4. doi: 10.1016/j.cancergencyto.2007.11.001.
• [30] Expanding the genotype-phenotype spectrum in hereditary colorectal cancer by gene panel testing.Fam Cancer. 2017 Apr;16(2):195-203. doi: 10.1007/s10689-016-9934-0.
• [31] Screening of BMPR1a for pathogenic mutations in familial colorectal cancer type X families from Newfoundland.Fam Cancer. 2018 Apr;17(2):205-208. doi: 10.1007/s10689-017-0016-8.
• [32] Overlap of Juvenile polyposis syndrome and Cowden syndrome due to de novo chromosome 10 deletion involving BMPR1A and PTEN: implications for treatment and surveillance.Am J Med Genet A. 2015 Jun;167(6):1305-8. doi: 10.1002/ajmg.a.36876. Epub 2015 Apr 5.
• [33] Germline bone morphogenesis protein receptor 1A mutation causes colorectal tumorigenesis in hereditary mixed polyposis syndrome.Am J Gastroenterol. 2009 Dec;104(12):3027-33. doi: 10.1038/ajg.2009.542. Epub 2009 Sep 22.
• [34] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [35] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [36] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [37] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [38] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [39] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [40] A HAMP promoter bioassay system for identifying chemical compounds that modulate hepcidin expression. Exp Hematol. 2015 May;43(5):404-413.e5. doi: 10.1016/j.exphem.2015.01.005. Epub 2015 Jan 26.
• [41] Adenosine and Cordycepin Accelerate Tissue Remodeling Process through Adenosine Receptor Mediated Wnt/-Catenin Pathway Stimulation by Regulating GSK3b Activity. Int J Mol Sci. 2021 May 25;22(11):5571. doi: 10.3390/ijms22115571.
• [42] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [43] Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
• [44] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [45] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [46] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [47] Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
• [48] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.