Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU4T99W)

• DOT Name: Serine--tRNA ligase, mitochondrial (SARS2)
• Synonyms: EC 6.1.1.11; SerRSmt; Seryl-tRNA synthetase; SerRS; Seryl-tRNA(Ser/Sec) synthetase
• Gene Name: SARS2
• Related Disease:
  Myocardial infarction
  Brain disease
  Chikungunya virus infection
  Colon carcinoma
  Common cold
  Dengue
  Ebola virus infection
  Encephalitis
  Enterovirus infection
  Gastroenteritis
  Hepatitis
  Hepatitis A virus infection
  Hepatocellular carcinoma
  Hyperuricemia-pulmonary hypertension-renal failure-alkalosis syndrome
  Intellectual disability
  Lung cancer
  Lung carcinoma
  Measles
  Melanoma
  Middle East Respiratory Syndrome (MERS)
  Neoplasm
  Pneumonitis
  Prostate cancer
  Prostate carcinoma
  Pulmonary fibrosis
  Respiratory disease
  Respiratory failure
  Syphilis
  Tuberculosis
  Advanced cancer
  Clear cell renal carcinoma
  Influenza
  Mitochondrial disease
  Pancreatic cancer
  Renal cell carcinoma
  Stroke
  Adult respiratory distress syndrome
  Pneumonia
  Rabies
  Breast cancer
  Breast carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Gonorrhea
  Liver cancer
  Mitochondrial myopathy
  Multiple sclerosis
  Pneumococcal infection
  Pulmonary disease
  Sexually transmitted infection
  Type-1 diabetes
• UniProt ID: SYSM_HUMAN
• PDB ID: 7TZB; 7U2A; 7U2B; 7YDF; 7YDG; 8FFY
• EC Number: 6.1.1.11
• Pfam ID: PF00587
• Sequence:
  MAASMARRLWPLLTRRGFRPRGGCISNDSPRRSFTTEKRNRNLLYEYAREGYSALPQLDI
  ERFCACPEEAAHALELRKGELRSADLPAIISTWQELRQLQEQIRSLEEEKAAVTEAVRAL
  LANQDSGEVQQDPKYQGLRARGREIRKELVHLYPREAQLEEQFYLQALKLPNQTHPDVPV
  GDESQARVLHMVGDKPVFSFQPRGHLEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQH
  GLVNFTFNKLLRRGFTPMTVPDLLRGAVFEGCGMTPNANPSQIYNIDPARFKDLNLAGTA
  EVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPG
  LEQSSQLLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVT
  SASNCTDFQSRRLHIMFQTEAGELQFAHTVNATACAVPRLLIALLESNQQKDGSVLVPPA
  LQSYLGTDRITAPTHVPLQYIGPNQPRKPGLPGQPAVS
• Function: Catalyzes the attachment of serine to tRNA(Ser). Is also probably able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec).
• KEGG Pathway: Aminoacyl-tR. biosynthesis (hsa00970)
• Reactome Pathway: Mitochondrial tRNA aminoacylation (R-HSA-379726)

Molecular Interaction Atlas (MIA) of This DOT

50 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Myocardial infarction	DIS655KI	Definitive	Biomarker	[1]
Brain disease	DIS6ZC3X	Strong	Biomarker	[2]
Chikungunya virus infection	DISDXEHY	Strong	Biomarker	[3]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[4]
Common cold	DIS3MADM	Strong	Genetic Variation	[5]
Dengue	DISKH221	Strong	Genetic Variation	[6]
Ebola virus infection	DISJAVM1	Strong	Biomarker	[7]
Encephalitis	DISLD1RL	Strong	Biomarker	[8]
Enterovirus infection	DISH2UDP	Strong	Biomarker	[9]
Gastroenteritis	DISXQCG5	Strong	Biomarker	[10]
Hepatitis	DISXXX35	Strong	Biomarker	[11]
Hepatitis A virus infection	DISUMFQV	Strong	Biomarker	[11]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[12]
Hyperuricemia-pulmonary hypertension-renal failure-alkalosis syndrome	DIS2WNMZ	Strong	Autosomal recessive	[13]
Intellectual disability	DISMBNXP	Strong	Genetic Variation	[14]
Lung cancer	DISCM4YA	Strong	Biomarker	[15]
Lung carcinoma	DISTR26C	Strong	Biomarker	[15]
Measles	DISXSUID	Strong	Genetic Variation	[16]
Melanoma	DIS1RRCY	Strong	Altered Expression	[17]
Middle East Respiratory Syndrome (MERS)	DIS5VPYU	Strong	Biomarker	[3]
Neoplasm	DISZKGEW	Strong	Biomarker	[18]
Pneumonitis	DIS88E0K	Strong	Biomarker	[19]
Prostate cancer	DISF190Y	Strong	Biomarker	[20]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[20]
Pulmonary fibrosis	DISQKVLA	Strong	Biomarker	[21]
Respiratory disease	DISGGAGJ	Strong	Biomarker	[22]
Respiratory failure	DISVMYJO	Strong	Genetic Variation	[2]
Syphilis	DISJ73BS	Strong	Biomarker	[23]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[24]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[25]
Clear cell renal carcinoma	DISBXRFJ	moderate	Biomarker	[26]
Influenza	DIS3PNU3	moderate	Genetic Variation	[27]
Mitochondrial disease	DISKAHA3	Moderate	Autosomal recessive	[28]
Pancreatic cancer	DISJC981	moderate	Biomarker	[29]
Renal cell carcinoma	DISQZ2X8	moderate	Biomarker	[26]
Stroke	DISX6UHX	moderate	Biomarker	[27]
Adult respiratory distress syndrome	DISIJV47	Disputed	Biomarker	[30]
Pneumonia	DIS8EF3M	Disputed	Biomarker	[31]
Rabies	DISSC4V5	Disputed	Biomarker	[32]
Breast cancer	DIS7DPX1	Limited	Biomarker	[33]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[33]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Biomarker	[34]
Gonorrhea	DISQ5AO6	Limited	Biomarker	[35]
Liver cancer	DISDE4BI	Limited	Biomarker	[34]
Mitochondrial myopathy	DIS9SA7V	Limited	Genetic Variation	[36]
Multiple sclerosis	DISB2WZI	Limited	Biomarker	[37]
Pneumococcal infection	DIS6SXQD	Limited	Biomarker	[38]
Pulmonary disease	DIS6060I	Limited	Altered Expression	[39]
Sexually transmitted infection	DISIVIAL	Limited	Biomarker	[35]
Type-1 diabetes	DIS7HLUB	Limited	Biomarker	[37]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Serine--tRNA ligase, mitochondrial (SARS2).	[40]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Serine--tRNA ligase, mitochondrial (SARS2).	[41]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Serine--tRNA ligase, mitochondrial (SARS2).	[42]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Serine--tRNA ligase, mitochondrial (SARS2).	[43]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Serine--tRNA ligase, mitochondrial (SARS2).	[44]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Serine--tRNA ligase, mitochondrial (SARS2).	[45]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Serine--tRNA ligase, mitochondrial (SARS2).	[46]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Serine--tRNA ligase, mitochondrial (SARS2).	[47]

References

• [1] Cardiomyocyte-specific overexpression of NO synthase-3 protects against myocardial ischemia-reperfusion injury.Arterioscler Thromb Vasc Biol. 2006 Jul;26(7):1517-23. doi: 10.1161/01.ATV.0000224324.52466.e6. Epub 2006 Apr 27.
• [2] Severe acute respiratory syndrome coronavirus infection causes neuronal death in the absence of encephalitis in mice transgenic for human ACE2.J Virol. 2008 Aug;82(15):7264-75. doi: 10.1128/JVI.00737-08. Epub 2008 May 21.
• [3] Identification of 6'--fluoro-homoaristeromycin as a potent inhibitor of chikungunya virus replication.Eur J Med Chem. 2020 Feb 1;187:111956. doi: 10.1016/j.ejmech.2019.111956. Epub 2019 Dec 9.
• [4] Inhibition of cytokine gene expression and induction of chemokine genes in non-lymphatic cells infected with SARS coronavirus.Virol J. 2006 Mar 29;3:17. doi: 10.1186/1743-422X-3-17.
• [5] Structural model of the SARS coronavirus E channel in LMPG micelles.Biochim Biophys Acta Biomembr. 2018 Jun;1860(6):1309-1317. doi: 10.1016/j.bbamem.2018.02.017. Epub 2018 Feb 21.
• [6] Structurally- and dynamically-driven allostery of the chymotrypsin-like proteases of SARS, Dengue and Zika viruses.Prog Biophys Mol Biol. 2019 May;143:52-66. doi: 10.1016/j.pbiomolbio.2018.08.009. Epub 2018 Sep 11.
• [7] Measles-derived vaccines to prevent emerging viral diseases.Microbes Infect. 2018 Oct-Nov;20(9-10):493-500. doi: 10.1016/j.micinf.2018.01.005. Epub 2018 Feb 1.
• [8] Strategies of highly pathogenic RNA viruses to block dsRNA detection by RIG-I-like receptors: hide, mask, hit.Antiviral Res. 2013 Dec;100(3):615-35. doi: 10.1016/j.antiviral.2013.10.002. Epub 2013 Oct 12.
• [9] Identification and evaluation of potent Middle East respiratory syndrome coronavirus (MERS-CoV) 3CLPro inhibitors. Antiviral Res. 2017 May;141:101-106.
• [10] Two-way antigenic cross-reactivity between severe acute respiratory syndrome coronavirus (SARS-CoV) and group 1 animal CoVs is mediated through an antigenic site in the N-terminal region of the SARS-CoV nucleoprotein.J Virol. 2007 Dec;81(24):13365-77. doi: 10.1128/JVI.01169-07. Epub 2007 Oct 3.
• [11] Severe acute respiratory syndrome coronavirus protein 6 accelerates murine hepatitis virus infections by more than one mechanism.J Virol. 2008 Jul;82(14):7212-22. doi: 10.1128/JVI.02406-07. Epub 2008 Apr 30.
• [12] S protein of severe acute respiratory syndrome-associated coronavirus mediates entry into hepatoma cell lines and is targeted by neutralizing antibodies in infected patients.J Virol. 2004 Jun;78(12):6134-42. doi: 10.1128/JVI.78.12.6134-6142.2004.
• [13] A new mutation in the gene encoding mitochondrial seryl-tRNA synthetase as a cause of HUPRA syndrome. BMC Nephrol. 2013 Sep 13;14:195. doi: 10.1186/1471-2369-14-195.
• [14] Mutations of the aminoacyl-tRNA-synthetases SARS and WARS2 are implicated in the etiology of autosomal recessive intellectual disability. Hum Mutat. 2017 Jun;38(6):621-636. doi: 10.1002/humu.23205. Epub 2017 Mar 23.
• [15] Ultrasensitive Detection of Circulating Tumor DNA of Lung Cancer via an Enzymatically Amplified SERS-Based Frequency Shift Assay.ACS Appl Mater Interfaces. 2019 May 22;11(20):18145-18152. doi: 10.1021/acsami.9b02953. Epub 2019 May 10.
• [16] Virucidal activity of a scorpion venom peptide variant mucroporin-M1 against measles, SARS-CoV and influenza H5N1 viruses.Peptides. 2011 Jul;32(7):1518-25. doi: 10.1016/j.peptides.2011.05.015. Epub 2011 May 19.
• [17] Targeting Angiogenesis by Blocking the ATM-SerRS-VEGFA Pathway for UV-Induced Skin Photodamage and Melanoma Growth.Cancers (Basel). 2019 Nov 22;11(12):1847. doi: 10.3390/cancers11121847.
• [18] Imaging Tumor Oxidative Stress with Surface Enhanced Raman Scattering Gold Nanoparticles.J Biomed Nanotechnol. 2019 Oct 1;15(10):2130-2141. doi: 10.1166/jbn.2019.2819.
• [19] Inhibition of NF-B-mediated inflammation in severe acute respiratory syndrome coronavirus-infected mice increases survival.J Virol. 2014 Jan;88(2):913-24. doi: 10.1128/JVI.02576-13. Epub 2013 Nov 6.
• [20] Silver nanoparticles deposited on graphene oxide for ultrasensitive surface-enhanced Raman scattering immunoassay of cancer biomarker.Nanoscale. 2018 Jul 5;10(25):11942-11947. doi: 10.1039/c8nr02820f.
• [21] Early upregulation of acute respiratory distress syndrome-associated cytokines promotes lethal disease in an aged-mouse model of severe acute respiratory syndrome coronavirus infection.J Virol. 2009 Jul;83(14):7062-74. doi: 10.1128/JVI.00127-09. Epub 2009 May 6.
• [22] Complement Activation Contributes to Severe Acute Respiratory Syndrome Coronavirus Pathogenesis.mBio. 2018 Oct 9;9(5):e01753-18. doi: 10.1128/mBio.01753-18.
• [23] A short novel about the spread of two important diseases in history: syphilis and SARS.J Biol Regul Homeost Agents. 2017 APR-JUN;31(2 Suppl. 2):183-186.
• [24] Bayesian inference of transmission chains using timing of symptoms, pathogen genomes and contact data.PLoS Comput Biol. 2019 Mar 29;15(3):e1006930. doi: 10.1371/journal.pcbi.1006930. eCollection 2019 Mar.
• [25] Plasmonic Cu(2- x)S (y)Se(1- y) Nanoparticles Catalyzed Click Chemistry Reaction for SERS Immunoassay of Cancer Biomarker.Anal Chem. 2018 Oct 2;90(19):11728-11733. doi: 10.1021/acs.analchem.8b03791. Epub 2018 Sep 12.
• [26] Effect of Switching Systemic Treatment After Stereotactic Radiosurgery for Oligoprogressive, Metastatic Renal Cell Carcinoma.Clin Genitourin Cancer. 2018 Oct;16(5):413-419.e1. doi: 10.1016/j.clgc.2018.07.018. Epub 2018 Aug 17.
• [27] Comparison of influenza disease burden in older populations of Hong Kong and Brisbane: the impact of influenza and pneumococcal vaccination.BMC Infect Dis. 2019 Feb 14;19(1):162. doi: 10.1186/s12879-019-3735-7.
• [28] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [29] Dual-SERS biosensor for one-step detection of microRNAs in exosome and residual plasma of blood samples for diagnosing pancreatic cancer.Biosens Bioelectron. 2019 Apr 1;130:204-213. doi: 10.1016/j.bios.2019.01.039. Epub 2019 Jan 25.
• [30] A decade after SARS: strategies for controlling emerging coronaviruses.Nat Rev Microbiol. 2013 Dec;11(12):836-48. doi: 10.1038/nrmicro3143. Epub 2013 Nov 11.
• [31] The role of host genetic factors in respiratory tract infectious diseases: systematic review, meta-analyses and field synopsis.Sci Rep. 2015 Nov 3;5:16119. doi: 10.1038/srep16119.
• [32] Feature selection methods for identifying genetic determinants of host species in RNA viruses.PLoS Comput Biol. 2013;9(10):e1003254. doi: 10.1371/journal.pcbi.1003254. Epub 2013 Oct 10.
• [33] Tissue factor-specific ultra-bright SERRS nanostars for Raman detection of pulmonary micrometastases.Nanoscale. 2017 Jan 19;9(3):1110-1119. doi: 10.1039/c6nr08217c.
• [34] Ultrasensitive Detection of Serum MicroRNA Using Branched DNA-Based SERS Platform Combining Simultaneous Detection of -Fetoprotein for Early Diagnosis of Liver Cancer.ACS Appl Mater Interfaces. 2018 Oct 17;10(41):34869-34877. doi: 10.1021/acsami.8b10252. Epub 2018 Oct 5.
• [35] Surface enhanced Raman spectroscopy of Chlamydia trachomatis and Neisseria gonorrhoeae for diagnostics, and extra-cellular metabolomics and biochemical monitoring.Sci Rep. 2018 Mar 26;8(1):5163. doi: 10.1038/s41598-018-23562-5.
• [36] Late-onset mitochondrial myopathy with dystrophic changes due to a G7497A mutation in the mitochondrial tRNA(Ser(UCN)) gene.Acta Neuropathol. 2005 Oct;110(4):426-30. doi: 10.1007/s00401-005-1063-z. Epub 2005 Aug 25.
• [37] Innate resistance to flavivirus infections and the functions of 2'-5' oligoadenylate synthetases.Curr Top Microbiol Immunol. 2008;321:85-100. doi: 10.1007/978-3-540-75203-5_4.
• [38] TaqMan real time RT-PCR assays for detecting ferret innate and adaptive immune responses.J Virol Methods. 2014 Sep 1;205:38-52. doi: 10.1016/j.jviromet.2014.04.014. Epub 2014 May 4.
• [39] Pulmonary Angiotensin-Converting Enzyme 2 (ACE2) and Inflammatory Lung Disease.Shock. 2016 Sep;46(3):239-48. doi: 10.1097/SHK.0000000000000633.
• [40] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [41] Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
• [42] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [43] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [44] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [45] Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
• [46] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [47] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.