Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVBWAV5)

• DOT Name: Tenascin-X (TNXB)
• Synonyms: TN-X; Hexabrachion-like protein
• Gene Name: TNXB
• Related Disease:
  Ehlers-Danlos syndrome due to tenascin-X deficiency
  Psoriasis
  Trichohepatoenteric syndrome
  Acquired immune deficiency syndrome
  Anorexia nervosa cachexia
  Breast carcinoma
  Connective tissue disorder
  Constipation
  Endometrial cancer
  Endometrial carcinoma
  Esophageal squamous cell carcinoma
  High blood pressure
  Immunodeficiency
  Lung adenocarcinoma
  Mesothelioma
  Multiple sclerosis
  Myocardial infarction
  Myopathy
  Neuromyelitis optica
  Osteogenesis imperfecta
  Ovarian cancer
  Serous cystadenocarcinoma
  Stroke
  Systemic lupus erythematosus
  Systemic sclerosis
  Type-1 diabetes
  Ventricular septal defect
  Vitiligo
  Chronic obstructive pulmonary disease
  Glycogen storage disease type II
  Malignant mesothelioma
  Neurofibromatosis type 1
  Vesicoureteral reflux
  Familial vesicoureteral reflux
  Anca-associated vasculitis
  Atopic dermatitis
  Chronic kidney disease
  Congenital adrenal hyperplasia
  Lung carcinoma
  Lung squamous cell carcinoma
  Neoplasm
  Psoriatic arthritis
  Rheumatoid arthritis
  Ulcerative colitis
  Vesicoureteral reflux 8
• UniProt ID: TENX_HUMAN
• PDB ID: 2CUH; 2CUI; 2CUM
• Pfam ID: PF07974 ; PF18720 ; PF00147 ; PF00041
• Sequence:
  MMPAQYALTSSLVLLVLLSTARAGPFSSRSNVTLPAPRPPPQPGGHTVGAGVGSPSSQLY
  EHTVEGGEKQVVFTHRINLPPSTGCGCPPGTEPPVLASEVQALRVRLEILEELVKGLKEQ
  CTGGCCPASAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSP
  PSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCVQGVCVCRAGFS
  GPDCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPRGCSQRGRCENGRCVCNPG
  YTGEDCGVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGRCVCW
  PGYTGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPGDCNQRGRCEDGRCV
  CWPGYTGTDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCESGR
  CMCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCED
  GVCVCDAGYSGEDCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCSQHGVC
  QDGVCICWEGYVSEDCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRG
  RCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCP
  GDCRGRGECHDGSCVCKDGYAGEDCGEEVPTIEGMRMHLLEETTVRTEWTPAPGPVDAYE
  IQFIPTTEGASPPFTARVPSSASAYDQRGLAPGQEYQVTVRALRGTSWGLPASKTITTMI
  DGPQDLRVVAVTPTTLELGWLRPQAEVDRFVVSYVSAGNQRVRLEVPPEADGTLLTDLMP
  GVEYVVTVTAERGRAVSYPASVRANTGSSPLGLLGTTDEPPPSGPSTTQGAQAPLLQQRP
  QELGELRVLGRDETGRLRVVWTAQPDTFAYFQLRMRVPEGPGAHEEVLPGDVRQALVPPP
  PPGTPYELSLHGVPPGGKPSDPIIYQGIMDKDEEKPGKSSGPPRLGELTVTDRTSDSLLL
  RWTVPEGEFDSFVIQYKDRDGQPQVVPVEGPQRSAVITSLDPGRKYKFVLYGFVGKKRHG
  PLVAEAKILPQSDPSPGTPPHLGNLWVTDPTPDSLHLSWTVPEGQFDTFMVQYRDRDGRP
  QVVPVEGPERSFVVSSLDPDHKYRFTLFGIANKKRYGPLTADGTTAPERKEEPPRPEFLE
  QPLLGELTVTGVTPDSLRLSWTVAQGPFDSFMVQYKDAQGQPQAVPVAGDENEVTVPGLD
  PDRKYKMNLYGLRGRQRVGPESVVAKTAPQEDVDETPSPTELGTEAPESPEEPLLGELTV
  TGSSPDSLSLFWTVPQGSFDSFTVQYKDRDGRPRAVRVGGKESEVTVGGLEPGHKYKMHL
  YGLHEGQRVGPVSAVGVTAPQQEETPPATESPLEPRLGELTVTDVTPNSVGLSWTVPEGQ
  FDSFIVQYKDKDGQPQVVPVAADQREVTVYNLEPERKYKMNMYGLHDGQRMGPLSVVIVT
  APLPPAPATEASKPPLEPRLGELTVTDITPDSVGLSWTVPEGEFDSFVVQYKDRDGQPQV
  VPVAADQREVTIPDLEPSRKYKFLLFGIQDGKRRSPVSVEAKTVARGDASPGAPPRLGEL
  WVTDPTPDSLRLSWTVPEGQFDSFVVQFKDKDGPQVVPVEGHERSVTVTPLDAGRKYRFL
  LYGLLGKKRHGPLTADGTTEARSAMDDTGTKRPPKPRLGEELQVTTVTQNSVGLSWTVPE
  GQFDSFVVQYKDRDGQPQVVPVEGSLREVSVPGLDPAHRYKLLLYGLHHGKRVGPISAVA
  ITAGREETETETTAPTPPAPEPHLGELTVEEATSHTLHLSWMVTEGEFDSFEIQYTDRDG
  QLQMVRIGGDRNDITLSGLESDHRYLVTLYGFSDGKHVGPVHVEALTVPEEEKPSEPPTA
  TPEPPIKPRLGELTVTDATPDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEEGV
  TISGLEPDHKYKMNLYGFHGGQRMGPVSVVGVTAAEEETPSPTEPSMEAPEPAEEPLLGE
  LTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQVVRVGGEESEVTVGGLEPGRKYK
  MHLYGLHEGRRVGPVSAVGVTAPEEESPDAPLAKLRLGQMTVRDITSDSLSLSWTVPEGQ
  FDHFLVQFKNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPVSAVGLT
  APGKDEEMAPASTEPPTPEPPIKPRLEELTVTDATPDSLSLSWTVPEGQFDHFLVQYKNG
  DGQPKATRVPGHEDRVTISGLEPDNKYKMNLYGFHGGQRVGPVSAIGVTAAEEETPSPTE
  PSMEAPEPPEEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQVVRVGGE
  ESEVTVGGLEPGRKYKMHLYGLHEGRRVGPVSTVGVTAPQEDVDETPSPTEPGTEAPGPP
  EEPLLGELTVTGSSPDSLSLSWTVPQGRFDSFTVQYKDRDGRPQAVRVGGQESKVTVRGL
  EPGRKYKMHLYGLHEGRRLGPVSAVGVTEDEAETTQAVPTMTPEPPIKPRLGELTMTDAT
  PDSLSLSWTVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFH
  GGQRVGPISVIGVTAAEEETPSPTELSTEAPEPPEEPLLGELTVTGSSPDSLSLSWTIPQ
  GHFDSFTVQYKDRDGRPQVMRVRGEESEVTVGGLEPGRKYKMHLYGLHEGRRVGPVSTVG
  VTAPEDEAETTQAVPTTTPEPPNKPRLGELTVTDATPDSLSLSWMVPEGQFDHFLVQYRN
  GDGQPKVVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRVGPISVIGVTAAEEETPAPT
  EPSTEAPEPPEEPLLGELTVTGSSPDSLSLSWTIPQGRFDSFTVQYKDRDGRPQVVRVRG
  EESEVTVGGLEPGCKYKMHLYGLHEGQRVGPVSAVGVTAPKDEAETTQAVPTMTPEPPIK
  PRLGELTVTDATPDSLSLSWMVPEGQFDHFLVQYRNGDGQPKAVRVPGHEDGVTISGLEP
  DHKYKMNLYGFHGGQRVGPVSAIGVTEEETPSPTEPSTEAPEAPEEPLLGELTVTGSSPD
  SLSLSWTVPQGRFDSFTVQYKDRDGQPQVVRVRGEESEVTVGGLEPGRKYKMHLYGLHEG
  QRVGPVSTVGITAPLPTPLPVEPRLGELAVAAVTSDSVGLSWTVAQGPFDSFLVQYRDAQ
  GQPQAVPVSGDLRAVAVSGLDPARKYKFLLFGLQNGKRHGPVPVEARTAPDTKPSPRLGE
  LTVTDATPDSVGLSWTVPEGEFDSFVVQYKDKDGRLQVVPVAANQREVTVQGLEPSRKYR
  FLLYGLSGRKRLGPISADSTTAPLEKELPPHLGELTVAEETSSSLRLSWTVAQGPFDSFV
  VQYRDTDGQPRAVPVAADQRTVTVEDLEPGKKYKFLLYGLLGGKRLGPVSALGMTAPEED
  TPAPELAPEAPEPPEEPRLGVLTVTDTTPDSMRLSWSVAQGPFDSFVVQYEDTNGQPQAL
  LVDGDQSKILISGLEPSTPYRFLLYGLHEGKRLGPLSAEGTTGLAPAGQTSEESRPRLSQ
  LSVTDVTTSSLRLNWEAPPGAFDSFLLRFGVPSPSTLEPHPRPLLQRELMVPGTRHSAVL
  RDLRSGTLYSLTLYGLRGPHKADSIQGTARTLSPVLESPRDLQFSEIRETSAKVNWMPPP
  SRADSFKVSYQLADGGEPQSVQVDGQARTQKLQGLIPGARYEVTVVSVRGFEESEPLTGF
  LTTVPDGPTQLRALNLTEGFAVLHWKPPQNPVDTYDVQVTAPGAPPLQAETPGSAVDYPL
  HDLVLHTNYTATVRGLRGPNLTSPASITFTTGLEAPRDLEAKEVTPRTALLTWTEPPVRP
  AGYLLSFHTPGGQNQEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTG
  GLRIPFPRDCGEEMQNGAGASRTSTIFLNGNRERPLNVFCDMETDGGGWLVFQRRMDGQT
  DFWRDWEDYAHGFGNISGEFWLGNEALHSLTQAGDYSMRVDLRAGDEAVFAQYDSFHVDS
  AAEYYRLHLEGYHGTAGDSMSYHSGSVFSARDRDPNSLLISCAVSYRGAWWYRNCHYANL
  NGLYGSTVDHQGVSWYHWKGFEFSVPFTEMKLRPRNFRSPAGGG
• Function: Appears to mediate interactions between cells and the extracellular matrix. Substrate-adhesion molecule that appears to inhibit cell migration. Accelerates collagen fibril formation. May play a role in supporting the growth of epithelial tumors.
• Tissue Specificity: Highly expressed in fetal adrenal, in fetal testis, fetal smooth, striated and cardiac muscle. Isoform XB-short is only expressed in the adrenal gland.
• KEGG Pathway:
  PI3K-Akt sig.ling pathway (hsa04151)
  Focal adhesion (hsa04510)
  ECM-receptor interaction (hsa04512)
  Human papillomavirus infection (hsa05165)
  MicroR.s in cancer (hsa05206)
• Reactome Pathway: ECM proteoglycans (R-HSA-3000178)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Ehlers-Danlos syndrome due to tenascin-X deficiency	DISPTVFJ	Definitive	Autosomal recessive	[1]
Psoriasis	DIS59VMN	Definitive	Biomarker	[2]
Trichohepatoenteric syndrome	DISL3ODF	Definitive	Biomarker	[2]
Acquired immune deficiency syndrome	DISL5UOX	Strong	Genetic Variation	[3]
Anorexia nervosa cachexia	DISFO5RQ	Strong	Posttranslational Modification	[4]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[5]
Connective tissue disorder	DISKXBS3	Strong	Biomarker	[6]
Constipation	DISRQXWI	Strong	Biomarker	[7]
Endometrial cancer	DISW0LMR	Strong	Biomarker	[8]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[8]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[9]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[10]
Immunodeficiency	DIS093I0	Strong	Biomarker	[6]
Lung adenocarcinoma	DISD51WR	Strong	Genetic Variation	[11]
Mesothelioma	DISKWK9M	Strong	Biomarker	[5]
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[12]
Myocardial infarction	DIS655KI	Strong	Biomarker	[13]
Myopathy	DISOWG27	Strong	Biomarker	[14]
Neuromyelitis optica	DISBFGKL	Strong	Genetic Variation	[15]
Osteogenesis imperfecta	DIS7XQSD	Strong	Genetic Variation	[16]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[5]
Serous cystadenocarcinoma	DISVK716	Strong	Biomarker	[5]
Stroke	DISX6UHX	Strong	Altered Expression	[13]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[17]
Systemic sclerosis	DISF44L6	Strong	Genetic Variation	[18]
Type-1 diabetes	DIS7HLUB	Strong	Genetic Variation	[19]
Ventricular septal defect	DISICO41	Strong	Genetic Variation	[20]
Vitiligo	DISR05SL	Strong	Genetic Variation	[21]
Chronic obstructive pulmonary disease	DISQCIRF	moderate	Genetic Variation	[22]
Glycogen storage disease type II	DISXZPBC	moderate	Genetic Variation	[23]
Malignant mesothelioma	DISTHJGH	moderate	Biomarker	[24]
Neurofibromatosis type 1	DIS53JH9	moderate	Altered Expression	[25]
Vesicoureteral reflux	DISUL6SA	moderate	Genetic Variation	[26]
Familial vesicoureteral reflux	DISUME5E	Supportive	Autosomal dominant	[26]
Anca-associated vasculitis	DISU3CNU	Limited	Genetic Variation	[19]
Atopic dermatitis	DISTCP41	Limited	Genetic Variation	[27]
Chronic kidney disease	DISW82R7	Limited	Genetic Variation	[19]
Congenital adrenal hyperplasia	DISG873W	Limited	Biomarker	[28]
Lung carcinoma	DISTR26C	Limited	Genetic Variation	[29]
Lung squamous cell carcinoma	DISXPIBD	Limited	Genetic Variation	[29]
Neoplasm	DISZKGEW	Limited	Biomarker	[30]
Psoriatic arthritis	DISLWTG2	Limited	Genetic Variation	[31]
Rheumatoid arthritis	DISTSB4J	Limited	Genetic Variation	[32]
Ulcerative colitis	DIS8K27O	Limited	Genetic Variation	[33]
Vesicoureteral reflux 8	DISDA2EP	Limited	Autosomal dominant	[34]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Lapatinib	DM3BH1Y	Approved	Tenascin-X (TNXB) increases the Hepatotoxicty ADR of Lapatinib.	[48]

6 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the methylation of Tenascin-X (TNXB).	[35]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Tenascin-X (TNXB).	[39]
Triclosan	DMZUR4N	Approved	Triclosan decreases the methylation of Tenascin-X (TNXB).	[40]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Tenascin-X (TNXB).	[43]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Tenascin-X (TNXB).	[46]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Tenascin-X (TNXB).	[43]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Tenascin-X (TNXB).	[36]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Tenascin-X (TNXB).	[37]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Tenascin-X (TNXB).	[38]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Tenascin-X (TNXB).	[41]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Tenascin-X (TNXB).	[42]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Tenascin-X (TNXB).	[44]
GSK2110183	DMZHB37	Phase 2	GSK2110183 increases the expression of Tenascin-X (TNXB).	[45]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of Tenascin-X (TNXB).	[47]

References

• [1] Recognizing the tenascin-X deficient type of Ehlers-Danlos syndrome: a cross-sectional study in 17 patients. Clin Genet. 2017 Mar;91(3):411-425. doi: 10.1111/cge.12853. Epub 2016 Nov 4.
• [2] A recessive form of the Ehlers-Danlos syndrome caused by tenascin-X deficiency. N Engl J Med. 2001 Oct 18;345(16):1167-75. doi: 10.1056/NEJMoa002939.
• [3] Genomewide association study of an AIDS-nonprogression cohort emphasizes the role played by HLA genes (ANRS Genomewide Association Study 02).J Infect Dis. 2009 Feb 1;199(3):419-26. doi: 10.1086/596067.
• [4] High-throughput DNA methylation analysis in anorexia nervosa confirms TNXB hypermethylation.World J Biol Psychiatry. 2018 Apr;19(3):187-199. doi: 10.1080/15622975.2016.1190033. Epub 2016 Jul 1.
• [5] Tenascin-X is a novel diagnostic marker of malignant mesothelioma.Am J Surg Pathol. 2009 Nov;33(11):1673-82. doi: 10.1097/PAS.0b013e3181b6bde3.
• [6] Transplantation of reconstructed human skin on nude mice: a model system to study expression of human tenascin-X and elastic fiber components.Cell Tissue Res. 2005 Feb;319(2):279-87. doi: 10.1007/s00441-004-1011-6. Epub 2004 Nov 19.
• [7] The extracellular matrix glycoprotein tenascin-X regulates peripheral sensory and motor neurones.J Physiol. 2018 Sep;596(17):4237-4251. doi: 10.1113/JP276300. Epub 2018 Jul 18.
• [8] Identification of DNA methylation associated gene signatures in endometrial cancer via integrated analysis of DNA methylation and gene expression systematically.J Gynecol Oncol. 2017 Nov;28(6):e83. doi: 10.3802/jgo.2017.28.e83.
• [9] Exome-wide analyses identify low-frequency variant in CYP26B1 and additional coding variants associated with esophageal squamous cell carcinoma. Nat Genet. 2018 Mar;50(3):338-343. doi: 10.1038/s41588-018-0045-8. Epub 2018 Jan 29.
• [10] Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.Hum Mol Genet. 2015 Feb 1;24(3):865-74. doi: 10.1093/hmg/ddu478. Epub 2014 Sep 23.
• [11] A genome-wide association study of lung cancer identifies a region of chromosome 5p15 associated with risk for adenocarcinoma.Am J Hum Genet. 2009 Nov;85(5):679-91. doi: 10.1016/j.ajhg.2009.09.012. Epub 2009 Oct 15.
• [12] Evidence for VAV2 and ZNF433 as susceptibility genes for multiple sclerosis.J Neuroimmunol. 2010 Oct 8;227(1-2):162-6. doi: 10.1016/j.jneuroim.2010.06.003. Epub 2010 Jul 2.
• [13] Tenascin-X, collagen, and Ehlers-Danlos syndrome: tenascin-X gene defects can protect against adverse cardiovascular events.Med Hypotheses. 2013 Sep;81(3):443-7. doi: 10.1016/j.mehy.2013.06.005. Epub 2013 Jul 3.
• [14] Compound heterozygous mutations of the TNXB gene cause primary myopathy.Neuromuscul Disord. 2013 Aug;23(8):664-9. doi: 10.1016/j.nmd.2013.04.009. Epub 2013 Jun 12.
• [15] A whole-genome sequence study identifies genetic risk factors for neuromyelitis optica.Nat Commun. 2018 May 16;9(1):1929. doi: 10.1038/s41467-018-04332-3.
• [16] An overlapping phenotype of Osteogenesis imperfecta and Ehlers-Danlos syndrome due to a heterozygous mutation in COL1A1 and biallelic missense variants in TNXB identified by whole exome sequencing.Am J Med Genet A. 2016 Apr;170A(4):1080-5. doi: 10.1002/ajmg.a.37547. Epub 2016 Jan 22.
• [17] Genetic Alleles Associated with SLE Susceptibility and Clinical Manifestations in Hispanic Patients from the Dominican Republic.Curr Mol Med. 2019;19(3):164-171. doi: 10.2174/1566524019666190424130809.
• [18] Genome-wide association study of systemic sclerosis identifies CD247 as a new susceptibility locus.Nat Genet. 2010 May;42(5):426-9. doi: 10.1038/ng.565. Epub 2010 Apr 11.
• [19] Associations between genetic risk variants for kidney diseases and kidney disease etiology.Sci Rep. 2017 Oct 24;7(1):13944. doi: 10.1038/s41598-017-13356-6.
• [20] Levels of Circulating mRNA for the Tenascin-X (TNXB) Gene in Maternal Plasma at the Second Trimester in Pregnancies with Isolated Congenital Ventricular Septal Defects.Mol Diagn Ther. 2018 Apr;22(2):235-240. doi: 10.1007/s40291-018-0321-4.
• [21] Genome-wide association study for vitiligo identifies susceptibility loci at 6q27 and the MHC.Nat Genet. 2010 Jul;42(7):614-8. doi: 10.1038/ng.603. Epub 2010 Jun 6.
• [22] Targeted Sequencing of Lung Function Loci in Chronic Obstructive Pulmonary Disease Cases and Controls.PLoS One. 2017 Jan 23;12(1):e0170222. doi: 10.1371/journal.pone.0170222. eCollection 2017.
• [23] Associations of 6p21.3 Region with Age-related Macular Degeneration and Polypoidal Choroidal Vasculopathy.Sci Rep. 2016 Feb 10;6:20914. doi: 10.1038/srep20914.
• [24] Tenascin XB Is a Novel Diagnostic Marker for Malignant Mesothelioma.Anticancer Res. 2019 Feb;39(2):627-633. doi: 10.21873/anticanres.13156.
• [25] Microarray-based identification of tenascin C and tenascin XB, genes possibly involved in tumorigenesis associated with neurofibromatosis type 1.Clin Cancer Res. 2007 Jan 15;13(2 Pt 1):398-407. doi: 10.1158/1078-0432.CCR-06-0182. Epub 2007 Jan 3.
• [26] TNXB mutations can cause vesicoureteral reflux. J Am Soc Nephrol. 2013 Jul;24(8):1313-22. doi: 10.1681/ASN.2012121148. Epub 2013 Apr 25.
• [27] Genome-wide comparative analysis of atopic dermatitis and psoriasis gives insight into opposing genetic mechanisms.Am J Hum Genet. 2015 Jan 8;96(1):104-20. doi: 10.1016/j.ajhg.2014.12.004.
• [28] High-Throughput Screening for CYP21A1P-TNXA/TNXB Chimeric Genes Responsible for Ehlers-Danlos Syndrome in Patients with Congenital Adrenal Hyperplasia.J Mol Diagn. 2019 Sep;21(5):924-931. doi: 10.1016/j.jmoldx.2019.06.001. Epub 2019 Jun 21.
• [29] Large-scale association analysis identifies new lung cancer susceptibility loci and heterogeneity in genetic susceptibility across histological subtypes.Nat Genet. 2017 Jul;49(7):1126-1132. doi: 10.1038/ng.3892. Epub 2017 Jun 12.
• [30] Correlation of histopathologic characteristics to protein expression and function in malignant melanoma.PLoS One. 2017 Apr 26;12(4):e0176167. doi: 10.1371/journal.pone.0176167. eCollection 2017.
• [31] Genetic variation at the glycosaminoglycan metabolism pathway contributes to the risk of psoriatic arthritis but not psoriasis.Ann Rheum Dis. 2019 Mar;78(3):e214158. doi: 10.1136/annrheumdis-2018-214158. Epub 2018 Dec 14.
• [32] A genome-wide association study suggests contrasting associations in ACPA-positive versus ACPA-negative rheumatoid arthritis.Ann Rheum Dis. 2011 Feb;70(2):259-65. doi: 10.1136/ard.2009.126821. Epub 2010 Dec 14.
• [33] Genetic predictors of medically refractory ulcerative colitis.Inflamm Bowel Dis. 2010 Nov;16(11):1830-40. doi: 10.1002/ibd.21293.
• [34] Increased sensitivity for detection of carcinogen-induced DNA repair with the chain terminator dideoxythymidine. Biochem Biophys Res Commun. 1978 Aug 29;83(4):1538-44. doi: 10.1016/0006-291x(78)91396-7.
• [35] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [36] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [37] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [38] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [39] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [40] Pregnancy exposure to synthetic phenols and placental DNA methylation - An epigenome-wide association study in male infants from the EDEN cohort. Environ Pollut. 2021 Dec 1;290:118024. doi: 10.1016/j.envpol.2021.118024. Epub 2021 Aug 21.
• [41] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [42] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [43] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [44] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [45] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [46] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [47] Evaluation of estrogen receptor alpha activation by glyphosate-based herbicide constituents. Food Chem Toxicol. 2017 Oct;108(Pt A):30-42.
• [48] HLA-DQA1*02:01 is a major risk factor for lapatinib-induced hepatotoxicity in women with advanced breast cancer. J Clin Oncol. 2011 Feb 20;29(6):667-73. doi: 10.1200/JCO.2010.31.3197. Epub 2011 Jan 18.