Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVHOL9B)

• DOT Name: Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C)
• Synonyms: Antagonist decoy receptor for TRAIL/Apo-2L; Decoy TRAIL receptor without death domain; Decoy receptor 1; DcR1; Lymphocyte inhibitor of TRAIL; TNF-related apoptosis-inducing ligand receptor 3; TRAIL receptor 3; TRAIL-R3; TRAIL receptor without an intracellular domain; CD antigen CD263
• Gene Name: TNFRSF10C
• Related Disease:
  Adult glioblastoma
  Glioblastoma multiforme
  Intellectual disability
  Multiple sclerosis
  Neuroblastoma
  Adult lymphoma
  Advanced cancer
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cervical cancer
  Cervical carcinoma
  Ependymoma
  Epithelial ovarian cancer
  Hepatocellular carcinoma
  Juvenile idiopathic arthritis
  leukaemia
  Leukemia
  Lymphoma
  Malignant mesothelioma
  Metastatic malignant neoplasm
  Myelodysplastic syndrome
  Neoplasm
  Non-small-cell lung cancer
  Ovarian cancer
  Ovarian neoplasm
  Pediatric lymphoma
  Plasma cell myeloma
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Small lymphocytic lymphoma
  Systemic lupus erythematosus
  Ulcerative colitis
  Urinary bladder cancer
  Urinary bladder neoplasm
  Chronic obstructive pulmonary disease
  Crohn disease
  Melanoma
  Acute myelogenous leukaemia
  Adenocarcinoma
  Chronic pancreatitis
  Congenital contractural arachnodactyly
  Pancreatic cancer
  Post-traumatic stress disorder
  Promyelocytic leukaemia
• UniProt ID: TR10C_HUMAN
• Pfam ID: PF00020
• Sequence:
  MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRS
  EHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNEN
  SPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAE
  ETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTPASSHY
  LSCTIVGIIVLIVLLIVFV
• Function: Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.
• Tissue Specificity: Higher expression in normal tissues than in tumor cell lines. Highly expressed in peripheral blood lymphocytes, spleen, skeletal muscle, placenta, lung and heart.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Viral protein interaction with cytokine and cytokine receptor (hsa04061)
• Reactome Pathway: TP53 Regulates Transcription of Death Receptors and Ligands (R-HSA-6803211)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Definitive	Biomarker	[1]
Glioblastoma multiforme	DISK8246	Definitive	Biomarker	[1]
Intellectual disability	DISMBNXP	Definitive	Biomarker	[2]
Multiple sclerosis	DISB2WZI	Definitive	Biomarker	[3]
Neuroblastoma	DISVZBI4	Definitive	Posttranslational Modification	[4]
Adult lymphoma	DISK8IZR	Strong	Posttranslational Modification	[5]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[6]
Bladder cancer	DISUHNM0	Strong	Posttranslational Modification	[5]
Breast cancer	DIS7DPX1	Strong	Biomarker	[7]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[7]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[8]
Cervical cancer	DISFSHPF	Strong	Altered Expression	[9]
Cervical carcinoma	DIST4S00	Strong	Altered Expression	[9]
Ependymoma	DISUMRNZ	Strong	Biomarker	[10]
Epithelial ovarian cancer	DIS56MH2	Strong	Posttranslational Modification	[11]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[12]
Juvenile idiopathic arthritis	DISQZGBV	Strong	Biomarker	[13]
leukaemia	DISS7D1V	Strong	Posttranslational Modification	[5]
Leukemia	DISNAKFL	Strong	Posttranslational Modification	[5]
Lymphoma	DISN6V4S	Strong	Posttranslational Modification	[5]
Malignant mesothelioma	DISTHJGH	Strong	Posttranslational Modification	[5]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[14]
Myelodysplastic syndrome	DISYHNUI	Strong	Altered Expression	[15]
Neoplasm	DISZKGEW	Strong	Altered Expression	[16]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[16]
Ovarian cancer	DISZJHAP	Strong	Posttranslational Modification	[5]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[11]
Pediatric lymphoma	DIS51BK2	Strong	Posttranslational Modification	[5]
Plasma cell myeloma	DIS0DFZ0	Strong	Posttranslational Modification	[5]
Prostate cancer	DISF190Y	Strong	Altered Expression	[6]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[6]
Prostate neoplasm	DISHDKGQ	Strong	Genetic Variation	[6]
Small lymphocytic lymphoma	DIS30POX	Strong	Altered Expression	[17]
Systemic lupus erythematosus	DISI1SZ7	Strong	Altered Expression	[18]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[19]
Urinary bladder cancer	DISDV4T7	Strong	Posttranslational Modification	[5]
Urinary bladder neoplasm	DIS7HACE	Strong	Posttranslational Modification	[5]
Chronic obstructive pulmonary disease	DISQCIRF	moderate	Biomarker	[20]
Crohn disease	DIS2C5Q8	Disputed	Altered Expression	[21]
Melanoma	DIS1RRCY	Disputed	Altered Expression	[22]
Acute myelogenous leukaemia	DISCSPTN	Limited	Altered Expression	[23]
Adenocarcinoma	DIS3IHTY	Limited	Posttranslational Modification	[24]
Chronic pancreatitis	DISBUOMJ	Limited	Biomarker	[25]
Congenital contractural arachnodactyly	DISOM1K7	Limited	Posttranslational Modification	[26]
Pancreatic cancer	DISJC981	Limited	Biomarker	[27]
Post-traumatic stress disorder	DISHL1EY	Limited	Biomarker	[28]
Promyelocytic leukaemia	DISYGG13	Limited	Altered Expression	[23]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C).	[29]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C).	[30]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C).	[31]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C).	[32]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C).	[33]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C).	[34]
Selenium	DM25CGV	Approved	Selenium increases the expression of Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C).	[35]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C).	[36]
Menthol	DMG2KW7	Approved	Menthol decreases the expression of Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C).	[37]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C).	[38]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C).	[39]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C).	[42]
Glyphosate	DM0AFY7	Investigative	Glyphosate increases the expression of Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C).	[43]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C).	[40]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C).	[41]

References

• [1] B-cell CLL/lymphoma 3 promotes glioma cell proliferation and inhibits apoptosis through the oncogenic STAT3 pathway.Int J Oncol. 2016 Dec;49(6):2471-2479. doi: 10.3892/ijo.2016.3729. Epub 2016 Oct 12.
• [2] C21orf5, a new member of Dopey family involved in morphogenesis, could participate in neurological alterations and mental retardation in Down syndrome.DNA Res. 2005;12(3):203-10. doi: 10.1093/dnares/dsi004.
• [3] TRAIL/TRAIL receptor system and susceptibility to multiple sclerosis.PLoS One. 2011;6(7):e21766. doi: 10.1371/journal.pone.0021766. Epub 2011 Jul 21.
• [4] Methylation of tumor-suppressor genes in neuroblastoma: The RASSF1A gene is almost always methylated in primary tumors.Pediatr Blood Cancer. 2008 Jan;50(1):29-32. doi: 10.1002/pbc.21279.
• [5] Aberrant methylation of trail decoy receptor genes is frequent in multiple tumor types.Int J Cancer. 2004 May 1;109(5):786-92. doi: 10.1002/ijc.20041.
• [6] Genetic and epigenetic inactivation of TNFRSF10C in human prostate cancer.Prostate. 2009 Feb 15;69(3):327-35. doi: 10.1002/pros.20882.
• [7] Bisphenol S induced epigenetic and transcriptional changes in human breast cancer cell line MCF-7.Environ Pollut. 2019 Mar;246:697-703. doi: 10.1016/j.envpol.2018.12.084. Epub 2018 Dec 31.
• [8] Surface TRAIL decoy receptor-4 expression is correlated with TRAIL resistance in MCF7 breast cancer cells.BMC Cancer. 2005 May 25;5:54. doi: 10.1186/1471-2407-5-54.
• [9] Epigenetic inactivation of TRAIL decoy receptors at 8p12-21.3 commonly deleted region confers sensitivity to Apo2L/trail-Cisplatin combination therapy in cervical cancer.Genes Chromosomes Cancer. 2016 Feb;55(2):177-89. doi: 10.1002/gcc.22325. Epub 2015 Nov 6.
• [10] Pediatric supratentorial ependymomas show more frequent deletions on chromosome 9 than infratentorial ependymomas: a microsatellite analysis.Cancer Genet Cytogenet. 2009 Jun;191(2):90-6. doi: 10.1016/j.cancergencyto.2009.02.010.
• [11] TRAIL-R3-related apoptosis: epigenetic and expression analyses in women with ovarian neoplasia.Gynecol Oncol. 2012 Aug;126(2):268-73. doi: 10.1016/j.ygyno.2012.04.038. Epub 2012 Apr 30.
• [12] Expression of TNF-related apoptosis-inducing Ligand receptors and antitumor tumor effects of TNF-related apoptosis-inducing Ligand in human hepatocellular carcinoma.World J Gastroenterol. 2003 Nov;9(11):2433-40. doi: 10.3748/wjg.v9.i11.2433.
• [13] Gene expression signatures in polyarticular juvenile idiopathic arthritis demonstrate disease heterogeneity and offer a molecular classification of disease subsets.Arthritis Rheum. 2009 Jul;60(7):2113-23. doi: 10.1002/art.24534.
• [14] Metastatic susceptibility locus, an 8p hot-spot for tumour progression disrupted in colorectal liver metastases: 13 candidate genes examined at the DNA, mRNA and protein level.BMC Cancer. 2008 Jul 1;8:187. doi: 10.1186/1471-2407-8-187.
• [15] Expression of tumor necrosis factor-related apoptosis-inducing ligand, Apo2L, and its receptors in myelodysplastic syndrome: effects on in vitro hemopoiesis.Blood. 2001 Nov 15;98(10):3058-65. doi: 10.1182/blood.v98.10.3058.
• [16] Association of EGFR and KRAS mutations with expression of p-AKT, DR5 and DcR1 in non-small cell lung cancer.Neoplasma. 2017;64(2):182-191. doi: 10.4149/neo_2017_203.
• [17] Sensitization to TRAIL-induced apoptosis and modulation of FLICE-inhibitory protein in B chronic lymphocytic leukemia by actinomycin D.Leukemia. 2001 Dec;15(12):1868-77. doi: 10.1038/sj.leu.2402287.
• [18] TNF-related apoptosis-inducing ligand is involved in neutropenia of systemic lupus erythematosus.Blood. 2004 Jul 1;104(1):184-91. doi: 10.1182/blood-2003-12-4274. Epub 2004 Mar 4.
• [19] Epidemiology of inflammatory bowel disease in the Republic of San Marino: The "EPIMICI - San Marino" study.Dig Liver Dis. 2019 Feb;51(2):218-225. doi: 10.1016/j.dld.2018.08.016. Epub 2018 Aug 20.
• [20] Common Genetic Polymorphisms Influence Blood Biomarker Measurements in COPD.PLoS Genet. 2016 Aug 17;12(8):e1006011. doi: 10.1371/journal.pgen.1006011. eCollection 2016 Aug.
• [21] Sensitivity of intestinal fibroblasts to TNF-related apoptosis-inducing ligand-mediated apoptosis in Crohn's disease.Scand J Gastroenterol. 2008;43(11):1334-45. doi: 10.1080/00365520802200010.
• [22] Constitutional promoter methylation and risk of familial melanoma.Epigenetics. 2014 May;9(5):685-92. doi: 10.4161/epi.28151. Epub 2014 Feb 13.
• [23] TRAIL decoy receptors mediate resistance of acute myeloid leukemia cells to TRAIL.Haematologica. 2005 May;90(5):612-24.
• [24] Concomitant promoter methylation of multiple genes in lung adenocarcinomas from current, former and never smokers.Carcinogenesis. 2009 Jul;30(7):1132-8. doi: 10.1093/carcin/bgp114. Epub 2009 May 12.
• [25] In chronic pancreatitis, widespread emergence of TRAIL receptors in epithelia coincides with neoexpression of TRAIL by pancreatic stellate cells of early fibrotic areas.Lab Invest. 2003 Jun;83(6):825-36. doi: 10.1097/01.lab.0000073126.56932.46.
• [26] CpG-island methylation study of liver fluke-related cholangiocarcinoma.Br J Cancer. 2011 Apr 12;104(8):1313-8. doi: 10.1038/bjc.2011.102. Epub 2011 Mar 29.
• [27] JNK pathway inhibition selectively primes pancreatic cancer stem cells to TRAIL-induced apoptosis without affecting the physiology of normal tissue resident stem cells.Oncotarget. 2016 Mar 1;7(9):9890-906. doi: 10.18632/oncotarget.7066.
• [28] Decreased AGO2 and DCR1 in PBMCs from War Veterans with PTSD leads to diminished miRNA resulting in elevated inflammation.Transl Psychiatry. 2017 Aug 29;7(8):e1222. doi: 10.1038/tp.2017.185.
• [29] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [30] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [31] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [32] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [33] p53 hypersensitivity is the predominant mechanism of the unique responsiveness of testicular germ cell tumor (TGCT) cells to cisplatin. PLoS One. 2011 Apr 21;6(4):e19198. doi: 10.1371/journal.pone.0019198.
• [34] Peripheral blood expression of nuclear factor-kappab-regulated genes is associated with rheumatoid arthritis disease activity and responds differentially to anti-tumor necrosis factor-alpha versus methotrexate. J Rheumatol. 2007 Sep;34(9):1817-22. Epub 2007 Aug 1.
• [35] Changes in gene expression profiles in response to selenium supplementation among individuals with arsenic-induced pre-malignant skin lesions. Toxicol Lett. 2007 Mar 8;169(2):162-76. doi: 10.1016/j.toxlet.2007.01.006. Epub 2007 Jan 19.
• [36] Partial contribution of tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)/TRAIL receptor pathway to antitumor effects of interferon-alpha/5-fluorouracil against Hepatocellular Carcinoma. Clin Cancer Res. 2004 Dec 1;10(23):7884-95. doi: 10.1158/1078-0432.CCR-04-0794.
• [37] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [38] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [39] Resveratrol sensitized leukemia stem cell-like KG-1a cells to cytokine-induced killer cells-mediated cytolysis through NKG2D ligands and TRAIL receptors. Cancer Biol Ther. 2012 May;13(7):516-26. doi: 10.4161/cbt.19601. Epub 2012 May 1.
• [40] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [41] Effects of bisphenol A exposure on the proliferation and senescence of normal human mammary epithelial cells. Cancer Biol Ther. 2012 Mar;13(5):296-306. doi: 10.4161/cbt.18942. Epub 2012 Mar 1.
• [42] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [43] Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.