Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVNU9D9)

• DOT Name: Deleted in malignant brain tumors 1 protein (DMBT1)
• Synonyms: Glycoprotein 340; Gp-340; Hensin; Salivary agglutinin; SAG; Surfactant pulmonary-associated D-binding protein
• Gene Name: DMBT1
• Related Disease:
  Esophageal cancer
  Adenocarcinoma
  Adenoma
  Advanced cancer
  Anaplastic astrocytoma
  Bladder cancer
  Brain neoplasm
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Carcinoma
  Cholangiocarcinoma
  Chromosomal disorder
  Colon cancer
  Colonic neoplasm
  Crohn disease
  Familial adenomatous polyposis
  Gallbladder carcinoma
  Glioma
  Hepatitis
  Hepatitis A virus infection
  Hepatitis B virus infection
  Hepatocellular carcinoma
  leukaemia
  Leukemia
  Liver cirrhosis
  Malignant glioma
  Medulloblastoma
  Nasal polyp
  Neuroblastoma
  Skin cancer
  Squamous cell carcinoma
  Systemic lupus erythematosus
  Thyroid gland carcinoma
  Urinary bladder cancer
  Urinary bladder neoplasm
  Ulcerative colitis
  Astrocytoma
  Colitis
  Inflammatory bowel disease
  Neuroendocrine neoplasm
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Pheochromocytoma
  Primary biliary cholangitis
  Prostate cancer
  Prostate carcinoma
  Small-cell lung cancer
• UniProt ID: DMBT1_HUMAN
• PDB ID: 6SA4; 6SA5; 6SAN
• Pfam ID: PF00431 ; PF00530 ; PF00100
• Sequence:
  MGISTVILEMCLLWGQVLSTGGWIPRTTDYASLIPSEVPLDPTVAEGSPFPSESTLESTV
  AEGSPISLESTLESTVAEGSLIPSESTLESTVAEGSDSGLALRLVNGDGRCQGRVEILYR
  GSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNAWFGQGSGPIALDDVRCSGHESYLWS
  CPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVRISPPVPTEGSESSLALRLVNGG
  DRCRGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNAQFGQGSGPIVLDD
  VRCSGHESYLWSCPHNGWLTHNCGHSEDAGVICSAPQSRPTPSPDTWPTSHASTAGPESS
  LALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPGNARFGQ
  GSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHSWSTPSPDTLPTIT
  LPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWA
  MLAPGNARFGQGSGPIVLDDVRCSGNESYLWSCPHNGWLSHNCGHSEDAGVICSGPESSL
  ALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPGNARFGQG
  SGPIVLDDVRCSGHESYLWSCPNNGWLSHNCGHHEDAGVICSAAQSRSTPRPDTLSTITL
  PPSTVGSESSLTLRLVNGSDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAT
  SAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSVSQSRPT
  PSPDTWPTSHASTAGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVC
  RQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVI
  CSAAHSWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYQGSWGTVCDD
  SWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSH
  NCGHSEDAGVICSASQSRPTPSPDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYR
  GSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWS
  CPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSHASTAGSESSLALRLVNGGDRC
  QGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRC
  SGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSHASTAGSESSLAL
  RLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSG
  PIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSRAST
  AGSESTLALRLVNGGDRCRGRVEVLYQGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPG
  NAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSAAQSQSTPRPD
  TWLTTNLPALTVGSESSLALRLVNGGDRCRGRVEVLYRGSWGTVCDDSWDTNDANVVCRQ
  LGCGWAMSAPGNARFGQGSGPIVLDDVRCSGNESYLWSCPHKGWLTHNCGHHEDAGVICS
  ATQINSTTTDWWHPTTTTTARPSSNCGGFLFYASGTFSSPSYPAYYPNNAKCVWEIEVNS
  GYRINLGFSNLKLEAHHNCSFDYVEIFDGSLNSSLLLGKICNDTRQIFTSSYNRMTIHFR
  SDISFQNTGFLAWYNSFPSDATLRLVNLNSSYGLCAGRVEIYHGGTWGTVCDDSWTIQEA
  EVVCRQLGCGRAVSALGNAYFGSGSGPITLDDVECSGTESTLWQCRNRGWFSHNCNHRED
  AGVICSGNHLSTPAPFLNITRPNTDYSCGGFLSQPSGDFSSPFYPGNYPNNAKCVWDIEV
  QNNYRVTVIFRDVQLEGGCNYDYIEVFDGPYRSSPLIARVCDGARGSFTSSSNFMSIRFI
  SDHSITRRGFRAEYYSSPSNDSTNLLCLPNHMQASVSRSYLQSLGFSASDLVISTWNGYY
  ECRPQITPNLVIFTIPYSGCGTFKQADNDTIDYSNFLTAAVSGGIIKRRTDLRIHVSCRM
  LQNTWVDTMYIANDTIHVANNTIQVEEVQYGNFDVNISFYTSSSFLYPVTSRPYYVDLNQ
  DLYVQAEILHSDAVLTLFVDTCVASPYSNDFTSLTYDLIRSGCVRDDTYGPYSSPSLRIA
  RFRFRAFHFLNRFPSVYLRCKMVVCRAYDPSSRCYRGCVLRSKRDVGSYQEKVDVVLGPI
  QLQTPPRREEEPR
• Function: May be considered as a candidate tumor suppressor gene for brain, lung, esophageal, gastric, and colorectal cancers. May play roles in mucosal defense system, cellular immune defense and epithelial differentiation. May play a role as an opsonin receptor for SFTPD and SPAR in macrophage tissues throughout the body, including epithelial cells lining the gastrointestinal tract. May play a role in liver regeneration. May be an important factor in fate decision and differentiation of transit-amplifying ductular (oval) cells within the hepatic lineage. Required for terminal differentiation of columnar epithelial cells during early embryogenesis. May function as a binding protein in saliva for the regulation of taste sensation. Binds to HIV-1 envelope protein and has been shown to both inhibit and facilitate viral transmission. Displays a broad calcium-dependent binding spectrum against both Gram-positive and Gram-negative bacteria, suggesting a role in defense against bacterial pathogens. Binds to a range of poly-sulfated and poly-phosphorylated ligands which may explain its broad bacterial-binding specificity. Inhibits cytoinvasion of S.enterica. Associates with the actin cytoskeleton and is involved in its remodeling during regulated exocytosis. Interacts with pancreatic zymogens in a pH-dependent manner and may act as a Golgi cargo receptor in the regulated secretory pathway of the pancreatic acinar cell.
• Tissue Specificity: Highly expressed in alveolar and macrophage tissues. In some macrophages, expression is seen on the membrane, and in other macrophages, strongly expressed in the phagosome/phagolysosome compartments. Expressed in lung, trachea, salivary gland, small intestine and stomach. In pancreas, expressed in certain cells of the islets of Langerhans. In digestive tract, confined to tissues with large epithelial surfaces. In intestinal tissue, moderately expressed in epithelial cells of the midcrypts and the crypt base. Expression is significantly elevated in intestinal tissue from patients with inflammatory bowel disease (IBD), particularly in surface epithelial and Paneth cells, but not in IBD patients with mutant NOD2. Present in crypt bases of the duodenum, in crypt tops of the colon, and in collecting ducts of the cortical kidney. Expressed in stratified squamous epithelium of vagina and in outer luminar surface and basilar region of columnar epithelial cells in cervix (at protein level). Isoform 1 is secreted to the lumen of the respiratory tract.
• KEGG Pathway: Salivary secretion (hsa04970)
• Reactome Pathway: Surfactant metabolism (R-HSA-5683826)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Esophageal cancer	DISGB2VN	Definitive	Biomarker	[1]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[2]
Adenoma	DIS78ZEV	Strong	Altered Expression	[3]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[4]
Anaplastic astrocytoma	DISSBE0K	Strong	Genetic Variation	[5]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[6]
Brain neoplasm	DISY3EKS	Strong	Biomarker	[7]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[8]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[8]
Breast neoplasm	DISNGJLM	Strong	Genetic Variation	[9]
Carcinoma	DISH9F1N	Strong	Altered Expression	[10]
Cholangiocarcinoma	DIS71F6X	Strong	Altered Expression	[11]
Chromosomal disorder	DISM5BB5	Strong	Biomarker	[12]
Colon cancer	DISVC52G	Strong	Biomarker	[13]
Colonic neoplasm	DISSZ04P	Strong	Biomarker	[13]
Crohn disease	DIS2C5Q8	Strong	Altered Expression	[14]
Familial adenomatous polyposis	DISW53RE	Strong	Biomarker	[15]
Gallbladder carcinoma	DISD6ACL	Strong	Biomarker	[4]
Glioma	DIS5RPEH	Strong	Genetic Variation	[16]
Hepatitis	DISXXX35	Strong	Altered Expression	[17]
Hepatitis A virus infection	DISUMFQV	Strong	Altered Expression	[17]
Hepatitis B virus infection	DISLQ2XY	Strong	Altered Expression	[17]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[17]
leukaemia	DISS7D1V	Strong	Genetic Variation	[18]
Leukemia	DISNAKFL	Strong	Genetic Variation	[18]
Liver cirrhosis	DIS4G1GX	Strong	Altered Expression	[17]
Malignant glioma	DISFXKOV	Strong	Genetic Variation	[16]
Medulloblastoma	DISZD2ZL	Strong	Genetic Variation	[19]
Nasal polyp	DISLP3XE	Strong	Biomarker	[20]
Neuroblastoma	DISVZBI4	Strong	Biomarker	[18]
Skin cancer	DISTM18U	Strong	Altered Expression	[21]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[22]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[23]
Thyroid gland carcinoma	DISMNGZ0	Strong	Altered Expression	[24]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[6]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[6]
Ulcerative colitis	DIS8K27O	moderate	Altered Expression	[14]
Astrocytoma	DISL3V18	Limited	Genetic Variation	[25]
Colitis	DISAF7DD	Limited	Altered Expression	[26]
Inflammatory bowel disease	DISGN23E	Limited	Altered Expression	[27]
Neuroendocrine neoplasm	DISNPLOO	Limited	Genetic Variation	[28]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Biomarker	[29]
Non-small-cell lung cancer	DIS5Y6R9	Limited	Altered Expression	[30]
Pheochromocytoma	DIS56IFV	Limited	Biomarker	[31]
Primary biliary cholangitis	DIS43E0O	Limited	Altered Expression	[32]
Prostate cancer	DISF190Y	Limited	Altered Expression	[33]
Prostate carcinoma	DISMJPLE	Limited	Altered Expression	[33]
Small-cell lung cancer	DISK3LZD	Limited	Altered Expression	[30]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Deleted in malignant brain tumors 1 protein (DMBT1) affects the response to substance of Cisplatin.	[41]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin affects the expression of Deleted in malignant brain tumors 1 protein (DMBT1).	[34]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Deleted in malignant brain tumors 1 protein (DMBT1).	[35]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Deleted in malignant brain tumors 1 protein (DMBT1).	[37]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of Deleted in malignant brain tumors 1 protein (DMBT1).	[38]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene affects the expression of Deleted in malignant brain tumors 1 protein (DMBT1).	[34]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Deleted in malignant brain tumors 1 protein (DMBT1).	[40]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Deleted in malignant brain tumors 1 protein (DMBT1).	[36]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Deleted in malignant brain tumors 1 protein (DMBT1).	[39]

References

• [1] Prostatic expression of hensin, a protein implicated in epithelial terminal differentiation.Prostate. 2001 Sep 15;49(1):9-18. doi: 10.1002/pros.1113.
• [2] Induction of DMBT1 expression by reduced ERK activity during a gastric mucosa differentiation-like process and its association with human gastric cancer.Carcinogenesis. 2005 Jun;26(6):1129-37. doi: 10.1093/carcin/bgi045. Epub 2005 Mar 10.
• [3] DMBT1 expression and glycosylation during the adenoma-carcinoma sequence in colorectal cancer.Biochem Soc Trans. 2005 Aug;33(Pt 4):730-2. doi: 10.1042/BST0330730.
• [4] DMBT1 suppresses progression of gallbladder carcinoma through PI3K/AKT signaling pathway by targeting PTEN.Biosci Biotechnol Biochem. 2019 Dec;83(12):2257-2264. doi: 10.1080/09168451.2019.1654361. Epub 2019 Aug 14.
• [5] PTEN, DMBT1, and p16 alterations in diffusely infiltrating astrocytomas.Int J Oncol. 2002 Sep;21(3):667-74.
• [6] Detection of deleted in malignant brain tumors 1 and runt-related transcription factor 3 gene expressions in bladder carcinoma.Mol Biol Rep. 2012 Apr;39(4):4691-5. doi: 10.1007/s11033-011-1261-9. Epub 2011 Sep 29.
• [7] A variant form of the human deleted in malignant brain tumor 1 (DMBT1) gene shows increased expression in inflammatory bowel diseases and interacts with dimeric trefoil factor 3 (TFF3).PLoS One. 2013 May 15;8(5):e64441. doi: 10.1371/journal.pone.0064441. Print 2013.
• [8] Identifying breast cancer risk loci by global differential allele-specific expression (DASE) analysis in mammary epithelial transcriptome.BMC Genomics. 2012 Oct 30;13:570. doi: 10.1186/1471-2164-13-570.
• [9] Genetic mapping in mice identifies DMBT1 as a candidate modifier of mammary tumors and breast cancer risk.Am J Pathol. 2007 Jun;170(6):2030-41. doi: 10.2353/ajpath.2007.060512.
• [10] Evaluation of deleted in malignant brain tumors 1 (DMBT1) gene expression in bladder carcinoma cases: preliminary study.Biomarkers. 2011 Nov;16(7):610-5. doi: 10.3109/1354750X.2011.620627. Epub 2011 Oct 15.
• [11] Decrease of deleted in malignant brain tumour-1 (DMBT-1) expression is a crucial late event in intrahepatic cholangiocarcinoma.Histopathology. 2003 Oct;43(4):340-6. doi: 10.1046/j.1365-2559.2003.01719.x.
• [12] Utility and limitations of multiplex ligation-dependent probe amplification technique in the detection of cytogenetic abnormalities in products of conception.J Postgrad Med. 2016 Oct-Dec;62(4):239-241. doi: 10.4103/0022-3859.192664.
• [13] Global gene expression analysis of rat colon cancers induced by a food-borne carcinogen, 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine.Carcinogenesis. 2004 Aug;25(8):1495-505. doi: 10.1093/carcin/bgh155. Epub 2004 Apr 1.
• [14] SALSA-A dance on a slippery floor with changing partners.Mol Immunol. 2017 Sep;89:100-110. doi: 10.1016/j.molimm.2017.05.029. Epub 2017 Jun 28.
• [15] Copy number of the Adenomatous Polyposis Coli gene is not always neutral in sporadic colorectal cancers with loss of heterozygosity for the gene.BMC Cancer. 2016 Mar 12;16:213. doi: 10.1186/s12885-016-2243-z.
• [16] DMBT1 polymorphisms: relationship to malignant glioma tumorigenesis.Cancer Res. 2002 Mar 15;62(6):1790-6.
• [17] Expression of deleted in malignant brain tumours 1 (DMBT1) relates to the proliferation and malignant transformation of hepatic progenitor cells in hepatitis B virus-related liver diseases.Histopathology. 2012 Jan;60(2):249-60. doi: 10.1111/j.1365-2559.2011.04082.x.
• [18] Silencing of DMBT1 in neuroblastoma cell lines is not due to methylation of CCWGG motifs on its promoter.Neoplasma. 2006;53(1):15-8.
• [19] PTEN and DMBT1 homozygous deletion and expression in medulloblastomas and supratentorial primitive neuroectodermal tumors.Oncol Rep. 2004 Dec;12(6):1341-7.
• [20] Silenced DMBT1 promotes nasal mucosa epithelial cell growth.Ann Hum Genet. 2018 Mar;82(2):102-108. doi: 10.1111/ahg.12230. Epub 2017 Nov 17.
• [21] Frequent downregulation of DMBT1 and galectin-3 in epithelial skin cancer.Int J Cancer. 2003 Jun 10;105(2):149-57. doi: 10.1002/ijc.11072.
• [22] Down-regulation of DMBT1 gene expression in human oral squamous cell carcinoma.Int J Mol Med. 2005 Apr;15(4):585-9.
• [23] The Possible Effect of B-Cell Epitopes of Epstein-Barr Virus Early Antigen, Membrane Antigen, Latent Membrane Protein-1, and -2A on Systemic Lupus Erythematosus.Front Immunol. 2018 Feb 12;9:187. doi: 10.3389/fimmu.2018.00187. eCollection 2018.
• [24] Expression of PDK-1 and DMBT1 in the thyroid carcinoma and its clinicopathological significance.Oncol Lett. 2019 Sep;18(3):2819-2824. doi: 10.3892/ol.2019.10639. Epub 2019 Jul 18.
• [25] DMBT1 homozygous deletion in diffuse astrocytomas is associated with unfavorable clinical outcome.J Neuropathol Exp Neurol. 2012 Aug;71(8):702-7. doi: 10.1097/NEN.0b013e31825f2e5d.
• [26] Copy number variation of scavenger-receptor cysteine-rich domains within DMBT1 and Crohn's disease.Eur J Hum Genet. 2016 Aug;24(9):1294-300. doi: 10.1038/ejhg.2015.280. Epub 2016 Jan 27.
• [27] Deleted in malignant brain tumor 1 is a novel prognostic marker in colorectal cancer.Oncol Rep. 2018 May;39(5):2279-2287. doi: 10.3892/or.2018.6287. Epub 2018 Mar 1.
• [28] Germline Missense Mutation of Deleted in Malignant Brain Tumor 1 (DMBT1) in Familial Mediastinal Neuroendocrine Cancer and in vitro Effects in Thyroid Cancer Cells.Neuroendocrinology. 2020;110(7-8):714-720. doi: 10.1159/000504369. Epub 2019 Oct 28.
• [29] Polymorphisms of the scavenger receptor class B member 1 are associated with insulin resistance with evidence of gene by sex interaction.J Clin Endocrinol Metab. 2009 May;94(5):1789-96. doi: 10.1210/jc.2008-2800. Epub 2009 Mar 10.
• [30] Expression of DMBT1, a candidate tumor suppressor gene, is frequently lost in lung cancer.Cancer Res. 1999 Apr 15;59(8):1846-51.
• [31] Gene expression profiling of rat pheochromocytoma.Ann N Y Acad Sci. 2006 Aug;1073:290-9. doi: 10.1196/annals.1353.033.
• [32] Heterogeneity of ductular reactions in adult rat and human liver revealed by novel expression of deleted in malignant brain tumor 1.Am J Pathol. 2002 Oct;161(4):1187-98. doi: 10.1016/S0002-9440(10)64395-7.
• [33] Loss of DMBT1 expression in human prostate cancer and its correlation with clinical progressive features.Urology. 2011 Feb;77(2):509.e9-13. doi: 10.1016/j.urology.2010.09.023. Epub 2010 Dec 16.
• [34] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [35] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [36] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [37] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [38] The putative tumor suppressor deleted in malignant brain tumors 1 is an estrogen-regulated gene in rodent and primate endometrial epithelium. Endocrinology. 2005 Mar;146(3):1066-73. doi: 10.1210/en.2004-1304. Epub 2004 Nov 24.
• [39] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [40] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [41] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.