Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVONVTB)

• DOT Name: Thy-1 membrane glycoprotein (THY1)
• Synonyms: CDw90; Thy-1 antigen; CD antigen CD90
• Gene Name: THY1
• Related Disease:
  Adult glioblastoma
  Alzheimer disease
  Amyotrophic lateral sclerosis
  B-cell neoplasm
  Breast carcinoma
  Crohn disease
  Endometriosis
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Glioma
  Glomerulonephritis
  Hepatocellular carcinoma
  Lung cancer
  Lung carcinoma
  Malignant glioma
  Malignant pleural mesothelioma
  Matthew-Wood syndrome
  Mesothelioma
  Myelodysplastic syndrome
  Neoplasm
  Nephritis
  Osteoarthritis
  Ovarian cancer
  Ovarian neoplasm
  Pancreatic cancer
  Parkinson disease
  Prostate cancer
  Prostate carcinoma
  Pulmonary fibrosis
  Retinopathy
  Squamous cell carcinoma
  Stroke
  Thyroid gland undifferentiated (anaplastic) carcinoma
  Type-1 diabetes
  Gastric cancer
  Lymphoma
  Melanoma
  Non-small-cell lung cancer
  Rheumatoid arthritis
  Stomach cancer
  Carcinoma of liver and intrahepatic biliary tract
  Liver cancer
  Breast cancer
  Malignant soft tissue neoplasm
  Myocardial infarction
  Obesity
  Sarcoma
• UniProt ID: THY1_HUMAN
• Pfam ID: PF00047
• Sequence:
  MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKK
  HVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNV
  TVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
• Function: May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.
• KEGG Pathway: Leukocyte transendothelial migration (hsa04670)
• Reactome Pathway: Post-translational modification (R-HSA-163125)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[1]
Alzheimer disease	DISF8S70	Strong	Biomarker	[2]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Genetic Variation	[3]
B-cell neoplasm	DISVY326	Strong	Altered Expression	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[5]
Crohn disease	DIS2C5Q8	Strong	Biomarker	[6]
Endometriosis	DISX1AG8	Strong	Biomarker	[7]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[8]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[9]
Glioma	DIS5RPEH	Strong	Biomarker	[10]
Glomerulonephritis	DISPZIQ3	Strong	Biomarker	[11]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[12]
Lung cancer	DISCM4YA	Strong	Biomarker	[13]
Lung carcinoma	DISTR26C	Strong	Biomarker	[14]
Malignant glioma	DISFXKOV	Strong	Biomarker	[15]
Malignant pleural mesothelioma	DIST2R60	Strong	Altered Expression	[16]
Matthew-Wood syndrome	DISA7HR7	Strong	Altered Expression	[17]
Mesothelioma	DISKWK9M	Strong	Altered Expression	[16]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[18]
Neoplasm	DISZKGEW	Strong	Altered Expression	[19]
Nephritis	DISQZQ70	Strong	Biomarker	[20]
Osteoarthritis	DIS05URM	Strong	Biomarker	[21]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[8]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[8]
Pancreatic cancer	DISJC981	Strong	Altered Expression	[17]
Parkinson disease	DISQVHKL	Strong	Biomarker	[22]
Prostate cancer	DISF190Y	Strong	Biomarker	[23]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[23]
Pulmonary fibrosis	DISQKVLA	Strong	Altered Expression	[24]
Retinopathy	DISB4B0F	Strong	Biomarker	[25]
Squamous cell carcinoma	DISQVIFL	Strong	Genetic Variation	[26]
Stroke	DISX6UHX	Strong	Biomarker	[27]
Thyroid gland undifferentiated (anaplastic) carcinoma	DISYBB1W	Strong	Biomarker	[28]
Type-1 diabetes	DIS7HLUB	Strong	Biomarker	[29]
Gastric cancer	DISXGOUK	moderate	Altered Expression	[30]
Lymphoma	DISN6V4S	moderate	Biomarker	[31]
Melanoma	DIS1RRCY	moderate	Altered Expression	[32]
Non-small-cell lung cancer	DIS5Y6R9	moderate	Altered Expression	[33]
Rheumatoid arthritis	DISTSB4J	moderate	Biomarker	[34]
Stomach cancer	DISKIJSX	moderate	Altered Expression	[30]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Disputed	Altered Expression	[35]
Liver cancer	DISDE4BI	Disputed	Altered Expression	[35]
Breast cancer	DIS7DPX1	Limited	Biomarker	[5]
Malignant soft tissue neoplasm	DISTC6NO	Limited	Biomarker	[36]
Myocardial infarction	DIS655KI	Limited	Altered Expression	[37]
Obesity	DIS47Y1K	Limited	Biomarker	[38]
Sarcoma	DISZDG3U	Limited	Biomarker	[36]

25 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Thy-1 membrane glycoprotein (THY1).	[39]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Thy-1 membrane glycoprotein (THY1).	[40]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Thy-1 membrane glycoprotein (THY1).	[41]
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of Thy-1 membrane glycoprotein (THY1).	[42]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Thy-1 membrane glycoprotein (THY1).	[43]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Thy-1 membrane glycoprotein (THY1).	[44]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Thy-1 membrane glycoprotein (THY1).	[45]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Thy-1 membrane glycoprotein (THY1).	[46]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Thy-1 membrane glycoprotein (THY1).	[47]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Thy-1 membrane glycoprotein (THY1).	[48]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Thy-1 membrane glycoprotein (THY1).	[49]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of Thy-1 membrane glycoprotein (THY1).	[50]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the expression of Thy-1 membrane glycoprotein (THY1).	[51]
Ximelegatran	DMU8ANS	Approved	Ximelegatran decreases the expression of Thy-1 membrane glycoprotein (THY1).	[52]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Thy-1 membrane glycoprotein (THY1).	[53]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Thy-1 membrane glycoprotein (THY1).	[54]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Thy-1 membrane glycoprotein (THY1).	[56]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Thy-1 membrane glycoprotein (THY1).	[57]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Thy-1 membrane glycoprotein (THY1).	[58]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Thy-1 membrane glycoprotein (THY1).	[59]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Thy-1 membrane glycoprotein (THY1).	[60]
Tributylstannanyl	DMHN7CB	Investigative	Tributylstannanyl decreases the expression of Thy-1 membrane glycoprotein (THY1).	[60]
Dibutyl phthalate	DMEDGKO	Investigative	Dibutyl phthalate increases the expression of Thy-1 membrane glycoprotein (THY1).	[61]
Methyl Mercury Ion	DM6YEW4	Investigative	Methyl Mercury Ion decreases the expression of Thy-1 membrane glycoprotein (THY1).	[60]
Ginsenoside RG3	DMFN58T	Investigative	Ginsenoside RG3 decreases the expression of Thy-1 membrane glycoprotein (THY1).	[62]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Thy-1 membrane glycoprotein (THY1).	[55]

References

• [1] CD90 Expression Controls Migration and Predicts Dasatinib Response in Glioblastoma.Clin Cancer Res. 2017 Dec 1;23(23):7360-7374. doi: 10.1158/1078-0432.CCR-17-1549. Epub 2017 Sep 22.
• [2] Changes in Synaptic Proteins Precede Neurodegeneration Markers in Preclinical Alzheimer's Disease Cerebrospinal Fluid.Mol Cell Proteomics. 2019 Mar;18(3):546-560. doi: 10.1074/mcp.RA118.001290. Epub 2019 Jan 3.
• [3] Loss of Ranbp2 in motoneurons causes disruption of nucleocytoplasmic and chemokine signaling, proteostasis of hnRNPH3 and Mmp28, and development of amyotrophic lateral sclerosis-like syndromes.Dis Model Mech. 2017 May 1;10(5):559-579. doi: 10.1242/dmm.027730. Epub 2017 Jan 18.
• [4] Anomalous expression of Thy1 (CD90) in B-cell lymphoma cells and proliferation inhibition by anti-Thy1 antibody treatment.Biochem Biophys Res Commun. 2010 May 28;396(2):329-34. doi: 10.1016/j.bbrc.2010.04.092. Epub 2010 Apr 18.
• [5] Tumor-Contacted Neutrophils Promote Metastasis by a CD90-TIMP-1 Juxtacrine-Paracrine Loop.Clin Cancer Res. 2019 Mar 15;25(6):1957-1969. doi: 10.1158/1078-0432.CCR-18-2544. Epub 2018 Nov 27.
• [6] Matrix metalloproteinases cleave membrane-bound PD-L1 on CD90+ (myo-)fibroblasts in Crohn's disease and regulate Th1/Th17 cell responses.Int Immunol. 2020 Jan 9;32(1):57-68. doi: 10.1093/intimm/dxz060.
• [7] Stem Cell Markers Describe a Transition From Somatic to Pluripotent Cell States in a Rat Model of Endometriosis.Reprod Sci. 2018 Jun;25(6):873-881. doi: 10.1177/1933719117697124. Epub 2017 Mar 21.
• [8] Thy-1 predicts poor prognosis and is associated with self-renewal in ovarian cancer.J Ovarian Res. 2019 Nov 17;12(1):112. doi: 10.1186/s13048-019-0590-5.
• [9] CD90 positive cells exhibit aggressive radioresistance in esophageal squamous cell carcinoma.J Thorac Dis. 2017 Mar;9(3):610-620. doi: 10.21037/jtd.2017.03.28.
• [10] Human Glioblastoma-Derived Mesenchymal Stem Cell to Pericytes Transition and Angiogenic Capacity in Glioblastoma Microenvironment.Cell Physiol Biochem. 2018;46(1):279-290. doi: 10.1159/000488429. Epub 2018 Mar 22.
• [11] Lycium barbarum polysaccharides attenuate rat anti-Thy-1 glomerulonephritis through mediating pyruvate dehydrogenase.Biomed Pharmacother. 2019 Aug;116:109020. doi: 10.1016/j.biopha.2019.109020. Epub 2019 May 29.
• [12] CAF-induced placental growth factor facilitates neoangiogenesis in hepatocellular carcinoma.Acta Biochim Biophys Sin (Shanghai). 2020 Jan 2;52(1):18-25. doi: 10.1093/abbs/gmz134.
• [13] Thy-1(+) Cancer-associated Fibroblasts Adversely Impact Lung Cancer Prognosis.Sci Rep. 2017 Jul 25;7(1):6478. doi: 10.1038/s41598-017-06922-5.
• [14] In Silico Selection Approach to Develop DNA Aptamers for a Stem-like Cell Subpopulation of Non-small Lung Cancer Adenocarcinoma Cell Line A549.Radiol Oncol. 2018 Mar 25;52(2):152-159. doi: 10.2478/raon-2018-0014. eCollection 2018 Jun.
• [15] Percentage of mesenchymal stem cells in high-grade glioma tumor samples correlates with patient survival.Neuro Oncol. 2017 May 1;19(5):660-668. doi: 10.1093/neuonc/now239.
• [16] Live-Cell Mesothelioma Biobank to Explore Mechanisms of Tumor Progression.Front Oncol. 2018 Feb 23;8:40. doi: 10.3389/fonc.2018.00040. eCollection 2018.
• [17] CD90 highly expressed population harbors a stemness signature and creates an immunosuppressive niche in pancreatic cancer.Cancer Lett. 2019 Jul 1;453:158-169. doi: 10.1016/j.canlet.2019.03.051. Epub 2019 Apr 4.
• [18] Perturbed hematopoietic stem and progenitor cell hierarchy in myelodysplastic syndromes patients with monosomy 7 as the sole cytogenetic abnormality.Oncotarget. 2016 Nov 8;7(45):72685-72698. doi: 10.18632/oncotarget.12234.
• [19] The Small Molecule Ephrin Receptor Inhibitor, GLPG1790, Reduces Renewal Capabilities of Cancer Stem Cells, Showing Anti-Tumour Efficacy on Preclinical Glioblastoma Models.Cancers (Basel). 2019 Mar 13;11(3):359. doi: 10.3390/cancers11030359.
• [20] The role of transcriptional factor D-site-binding protein in circadian CCL2 gene expression in anti-Thy1 nephritis.Cell Mol Immunol. 2019 Sep;16(9):735-745. doi: 10.1038/s41423-018-0020-4. Epub 2018 Mar 22.
• [21] Core regulatory RNA molecules identified in articular cartilage stem/progenitor cells during osteoarthritis progression.Epigenomics. 2019 May;11(6):669-684. doi: 10.2217/epi-2018-0212. Epub 2019 Feb 18.
• [22] Altered Gut Microbiome in Parkinson's Disease and the Influence of Lipopolysaccharide in a Human -Synuclein Over-Expressing Mouse Model.Front Neurosci. 2019 Aug 7;13:839. doi: 10.3389/fnins.2019.00839. eCollection 2019.
• [23] Tumor-infiltrating mesenchymal stem cells: Drivers of the immunosuppressive tumor microenvironment in prostate cancer?.Prostate. 2019 Feb;79(3):320-330. doi: 10.1002/pros.23738. Epub 2018 Nov 28.
• [24] Up-regulation of THY1 attenuates interstitial pulmonary fibrosis and promotes lung fibroblast apoptosis during acute interstitial pneumonia by blockade of the WNT signaling pathway.Cell Cycle. 2019 Mar-Apr;18(6-7):670-681. doi: 10.1080/15384101.2019.1578144. Epub 2019 Mar 4.
• [25] Resveratrol mitigates rat retinal ischemic injury: the roles of matrix metalloproteinase-9, inducible nitric oxide, and heme oxygenase-1.J Ocul Pharmacol Ther. 2013 Feb;29(1):33-40. doi: 10.1089/jop.2012.0141. Epub 2012 Oct 17.
• [26] The Role of CD90 in the Differential Diagnosis of Pleural Malignant Mesothelioma, Pulmonary Carcinoma and Comparison with Calretnn.Pathol Oncol Res. 2017 Jul;23(3):487-491. doi: 10.1007/s12253-016-0135-9. Epub 2016 Oct 19.
• [27] Enhanced functional recovery by levodopa is associated with decreased levels of synaptogyrin following stroke in aged mice.Brain Res Bull. 2020 Feb;155:61-66. doi: 10.1016/j.brainresbull.2019.11.019. Epub 2019 Dec 2.
• [28] Inhibition of Cancer Stem-Like Phenotype by Curcumin and Deguelin in CAL-62 Anaplastic Thyroid Cancer Cells.Anticancer Agents Med Chem. 2019;19(15):1887-1898. doi: 10.2174/1871520619666191004144025.
• [29] Transplantation of stem cells from umbilical cord blood as therapy for type I diabetes.Cell Tissue Res. 2019 Nov;378(2):155-162. doi: 10.1007/s00441-019-03046-2. Epub 2019 Jun 17.
• [30] MicroRNA-140-5p inhibits cell proliferation, migration and promotes cell apoptosis in gastric cancer through the negative regulation of THY1-mediated Notch signaling.Biosci Rep. 2019 Jul 23;39(7):BSR20181434. doi: 10.1042/BSR20181434. Print 2019 Jul 31.
• [31] Early Generated B-1-Derived B Cells Have the Capacity To Progress To Become Mantle Cell Lymphoma-like Neoplasia in Aged Mice.J Immunol. 2018 Jul 15;201(2):804-813. doi: 10.4049/jimmunol.1800400. Epub 2018 Jun 13.
• [32] Interaction of human Thy-1 (CD 90) with the integrin alphavbeta3 (CD51/CD61): an important mechanism mediating melanoma cell adhesion to activated endothelium.Oncogene. 2005 Jul 7;24(29):4710-20. doi: 10.1038/sj.onc.1208559.
• [33] Conditioned medium of primary lung cancer cells induces EMT in A549 lung cancer cell line by TGF-1 and miRNA21 cooperation.PLoS One. 2019 Jul 25;14(7):e0219597. doi: 10.1371/journal.pone.0219597. eCollection 2019.
• [34] Defining inflammatory cell states in rheumatoid arthritis joint synovial tissues by integrating single-cell transcriptomics and mass cytometry.Nat Immunol. 2019 Jul;20(7):928-942. doi: 10.1038/s41590-019-0378-1. Epub 2019 May 6.
• [35] TGF-1 accelerates the hepatitis B virus X-induced malignant transformation of hepatic progenitor cells by upregulating miR-199a-3p.Oncogene. 2020 Feb;39(8):1807-1820. doi: 10.1038/s41388-019-1107-9. Epub 2019 Nov 18.
• [36] Rapamycin may inhibit murine S180 sarcoma growth by regulating the pathways associated with autophagy and cancer stem cells.J Cancer Res Ther. 2019;15(2):398-403. doi: 10.4103/jcrt.JCRT_639_18.
• [37] Enhanced cardiac repair by telomerase reverse transcriptase over-expression in human cardiac mesenchymal stromal cells.Sci Rep. 2019 Jul 22;9(1):10579. doi: 10.1038/s41598-019-47022-w.
• [38] Thy1 (CD90) expression is regulated by DNA methylation during adipogenesis.FASEB J. 2019 Mar;33(3):3353-3363. doi: 10.1096/fj.201801481R. Epub 2018 Oct 30.
• [39] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [40] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [41] Estradiol and selective estrogen receptor modulators differentially regulate target genes with estrogen receptors alpha and beta. Mol Biol Cell. 2004 Mar;15(3):1262-72. doi: 10.1091/mbc.e03-06-0360. Epub 2003 Dec 29.
• [42] Fetal-sex dependent genomic responses in the circulating lymphocytes of arsenic-exposed pregnant women in New Hampshire. Reprod Toxicol. 2017 Oct;73:184-195. doi: 10.1016/j.reprotox.2017.07.023. Epub 2017 Aug 6.
• [43] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [44] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [45] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [46] Cannabidiol Modulates the Immunophenotype and Inhibits the Activation of the Inflammasome in Human Gingival Mesenchymal Stem Cells. Front Physiol. 2016 Nov 24;7:559. doi: 10.3389/fphys.2016.00559. eCollection 2016.
• [47] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [48] Chronic ethanol exposure increases goosecoid (GSC) expression in human embryonic carcinoma cell differentiation. J Appl Toxicol. 2014 Jan;34(1):66-75.
• [49] The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
• [50] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [51] Identification of selective inhibitors of cancer stem cells by high-throughput screening. Cell. 2009 Aug 21;138(4):645-659. doi: 10.1016/j.cell.2009.06.034. Epub 2009 Aug 13.
• [52] Effects of Y-27632 on the osteogenic and adipogenic potential of human dental pulp stem cells in vitro. Hum Exp Toxicol. 2022 Jan-Dec;41:9603271221089003. doi: 10.1177/09603271221089003.
• [53] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [54] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [55] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [56] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [57] Bisphenol A-induced epithelial to mesenchymal transition is mediated by cyclooxygenase-2 up-regulation in human endometrial carcinoma cells. Reprod Toxicol. 2015 Dec;58:229-33.
• [58] Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.
• [59] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [60] Inhibition of CXCL12-mediated chemotaxis of Jurkat cells by direct immunotoxicants. Arch Toxicol. 2016 Jul;90(7):1685-94. doi: 10.1007/s00204-015-1585-7. Epub 2015 Aug 28.
• [61] Phthalates stimulate the epithelial to mesenchymal transition through an HDAC6-dependent mechanism in human breast epithelial stem cells. Toxicol Sci. 2012 Aug;128(2):365-76. doi: 10.1093/toxsci/kfs163. Epub 2012 May 2.
• [62] Ginsenoside Rg3 attenuates the osimertinib resistance by reducing the stemness of non-small cell lung cancer cells. Environ Toxicol. 2020 Jun;35(6):643-651. doi: 10.1002/tox.22899. Epub 2020 Jan 9.