Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWCN39U)

• DOT Name: Disks large-associated protein 5 (DLGAP5)
• Synonyms: DAP-5; Discs large homolog 7; Disks large-associated protein DLG7; Hepatoma up-regulated protein; HURP
• Gene Name: DLGAP5
• Related Disease:
  Glioblastoma multiforme
  Adrenal cortex neoplasm
  Advanced cancer
  Bladder cancer
  Castration-resistant prostate carcinoma
  Gastric cancer
  Invasive breast carcinoma
  Neoplasm
  Non-small-cell lung cancer
  Prostate cancer
  Prostate carcinoma
  Stomach cancer
  Tarsal-carpal coalition syndrome
  Transitional cell carcinoma
  Urinary bladder cancer
  Urinary bladder neoplasm
  Colorectal carcinoma
  Neuroblastoma
  Hepatocellular carcinoma
  Lung cancer
  Lung carcinoma
  Schistosomiasis
• UniProt ID: DLGP5_HUMAN
• PDB ID: 7ZX4
• Pfam ID: PF03359
• Sequence:
  MSSSHFASRHRKDISTEMIRTKIAHRKSLSQKENRHKEYERNRHFGLKDVNIPTLEGRIL
  VELDETSQGLVPEKTNVKPRAMKTILGDQRKQMLQKYKEEKQLQKLKEQREKAKRGIFKV
  GRYRPDMPCFLLSNQNAVKAEPKKAIPSSVRITRSKAKDQMEQTKIDNESDVRAIRPGPR
  QTSEKKVSDKEKKVVQPVMPTSLRMTRSATQAAKQVPRTVSSTTARKPVTRAANENEPEG
  KVPSKGRPAKNVETKPDKGISCKVDSEENTLNSQTNATSGMNPDGVLSKMENLPEINTAK
  IKGKNSFAPKDFMFQPLDGLKTYQVTPMTPRSANAFLTPSYTWTPLKTEVDESQATKEIL
  AQKCKTYSTKTIQQDSNKLPCPLGPLTVWHEEHVLNKNEATTKNLNGLPIKEVPSLERNE
  GRIAQPHHGVPYFRNILQSETEKLTSHCFEWDRKLELDIPDDAKDLIRTAVGQTRLLMKE
  RFKQFEGLVDDCEYKRGIKETTCTDLDGFWDMVSFQIEDVIHKFNNLIKLEESGWQVNNN
  MNHNMNKNVFRKKVVSGIASKPKQDDAGRIAARNRLAAIKNAMRERIRQEECAETAVSVI
  PKEVDKIVFDAGFFRVESPVKLFSGLSVSSEGPSQRLGTPKSVNKAVSQSRNEMGIPQQT
  TSPENAGPQNTKSEHVKKTLFLSIPESRSSIEDAQCPGLPDLIEENHVVNKTDLKVDCLS
  SERMSLPLLAGGVADDINTNKKEGISDVVEGMELNSSITSQDVLMSSPEKNTASQNSILE
  EGETKISQSELFDNKSLTTECHLLDSPGLNCSNPFTQLERRHQEHARHISFGGNLITFSP
  LQPGEF
• Function: Potential cell cycle regulator that may play a role in carcinogenesis of cancer cells. Mitotic phosphoprotein regulated by the ubiquitin-proteasome pathway. Key regulator of adherens junction integrity and differentiation that may be involved in CDH1-mediated adhesion and signaling in epithelial cells.
• Tissue Specificity: Abundantly expressed in fetal liver. Expressed at lower levels in bone marrow, testis, colon, and placenta.
• Reactome Pathway: NOTCH3 Intracellular Domain Regulates Transcription (R-HSA-9013508)

Molecular Interaction Atlas (MIA) of This DOT

22 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Glioblastoma multiforme	DISK8246	Definitive	Biomarker	[1]
Adrenal cortex neoplasm	DISO17X1	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[3]
Bladder cancer	DISUHNM0	Strong	Biomarker	[4]
Castration-resistant prostate carcinoma	DISVGAE6	Strong	Altered Expression	[5]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[3]
Invasive breast carcinoma	DISANYTW	Strong	Biomarker	[6]
Neoplasm	DISZKGEW	Strong	Altered Expression	[7]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[8]
Prostate cancer	DISF190Y	Strong	Altered Expression	[5]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[5]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[3]
Tarsal-carpal coalition syndrome	DISY90L2	Strong	Altered Expression	[9]
Transitional cell carcinoma	DISWVVDR	Strong	Altered Expression	[8]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[4]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[4]
Colorectal carcinoma	DIS5PYL0	moderate	Altered Expression	[10]
Neuroblastoma	DISVZBI4	moderate	Altered Expression	[11]
Hepatocellular carcinoma	DIS0J828	Limited	Altered Expression	[7]
Lung cancer	DISCM4YA	Limited	Biomarker	[12]
Lung carcinoma	DISTR26C	Limited	Biomarker	[12]
Schistosomiasis	DIS6PD44	Limited	Altered Expression	[13]

44 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Disks large-associated protein 5 (DLGAP5).	[14]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Disks large-associated protein 5 (DLGAP5).	[15]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Disks large-associated protein 5 (DLGAP5).	[16]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Disks large-associated protein 5 (DLGAP5).	[17]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Disks large-associated protein 5 (DLGAP5).	[18]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Disks large-associated protein 5 (DLGAP5).	[19]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Disks large-associated protein 5 (DLGAP5).	[20]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Disks large-associated protein 5 (DLGAP5).	[21]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Disks large-associated protein 5 (DLGAP5).	[22]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Disks large-associated protein 5 (DLGAP5).	[23]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Disks large-associated protein 5 (DLGAP5).	[24]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Disks large-associated protein 5 (DLGAP5).	[25]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Disks large-associated protein 5 (DLGAP5).	[14]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Disks large-associated protein 5 (DLGAP5).	[25]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Disks large-associated protein 5 (DLGAP5).	[26]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Disks large-associated protein 5 (DLGAP5).	[27]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Disks large-associated protein 5 (DLGAP5).	[28]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Disks large-associated protein 5 (DLGAP5).	[29]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Disks large-associated protein 5 (DLGAP5).	[30]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Disks large-associated protein 5 (DLGAP5).	[31]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Disks large-associated protein 5 (DLGAP5).	[32]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Disks large-associated protein 5 (DLGAP5).	[33]
Piroxicam	DMTK234	Approved	Piroxicam increases the expression of Disks large-associated protein 5 (DLGAP5).	[34]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Disks large-associated protein 5 (DLGAP5).	[35]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of Disks large-associated protein 5 (DLGAP5).	[20]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of Disks large-associated protein 5 (DLGAP5).	[20]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Disks large-associated protein 5 (DLGAP5).	[36]
Methamphetamine	DMPM4SK	Approved	Methamphetamine decreases the expression of Disks large-associated protein 5 (DLGAP5).	[37]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Disks large-associated protein 5 (DLGAP5).	[38]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil increases the expression of Disks large-associated protein 5 (DLGAP5).	[20]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Disks large-associated protein 5 (DLGAP5).	[39]
DNCB	DMDTVYC	Phase 2	DNCB decreases the expression of Disks large-associated protein 5 (DLGAP5).	[40]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Disks large-associated protein 5 (DLGAP5).	[41]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Disks large-associated protein 5 (DLGAP5).	[42]
TAK-114	DMTXE19	Phase 1	TAK-114 decreases the expression of Disks large-associated protein 5 (DLGAP5).	[43]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Disks large-associated protein 5 (DLGAP5).	[44]
Eugenol	DM7US1H	Patented	Eugenol decreases the expression of Disks large-associated protein 5 (DLGAP5).	[40]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Disks large-associated protein 5 (DLGAP5).	[46]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Disks large-associated protein 5 (DLGAP5).	[47]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Disks large-associated protein 5 (DLGAP5).	[48]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Disks large-associated protein 5 (DLGAP5).	[49]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Disks large-associated protein 5 (DLGAP5).	[50]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Disks large-associated protein 5 (DLGAP5).	[51]
Dibutyl phthalate	DMEDGKO	Investigative	Dibutyl phthalate increases the expression of Disks large-associated protein 5 (DLGAP5).	[43]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Disks large-associated protein 5 (DLGAP5).	[45]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Disks large-associated protein 5 (DLGAP5).	[45]

References

• [1] Screening and authentication of molecular markers in malignant glioblastoma based on gene expression profiles.Oncol Lett. 2019 Nov;18(5):4593-4604. doi: 10.3892/ol.2019.10804. Epub 2019 Sep 4.
• [2] Gene expression profiling reveals a new classification of adrenocortical tumors and identifies molecular predictors of malignancy and survival.J Clin Oncol. 2009 Mar 1;27(7):1108-15. doi: 10.1200/JCO.2008.18.5678. Epub 2009 Jan 12.
• [3] Examination of the expression and prognostic significance of DLGAPs in gastric cancer using the TCGA database and bioinformatic analysis.Mol Med Rep. 2018 Dec;18(6):5621-5629. doi: 10.3892/mmr.2018.9574. Epub 2018 Oct 23.
• [4] Direct detection of unamplified hepatoma upregulated protein RNA in urine using gold nanoparticles for bladder cancer diagnosis.Clin Biochem. 2014 Jan;47(1-2):104-10. doi: 10.1016/j.clinbiochem.2013.10.022. Epub 2013 Oct 29.
• [5] Identification of new octamer transcription factor 1-target genes upregulated in castration-resistant prostate cancer.Cancer Sci. 2019 Nov;110(11):3476-3485. doi: 10.1111/cas.14183. Epub 2019 Sep 16.
• [6] Nucleolar and Spindle Associated Protein 1 (NUSAP1) Inhibits Cell Proliferation and Enhances Susceptibility to Epirubicin In Invasive Breast Cancer Cells by Regulating Cyclin D Kinase (CDK1) and DLGAP5 Expression.Med Sci Monit. 2018 Nov 26;24:8553-8564. doi: 10.12659/MSM.910364.
• [7] In vitro study of anti-ER positive breast cancer effect and mechanism of 1,2,3,4-6-pentyl-O-galloyl-beta-d-glucose (PGG).Biomed Pharmacother. 2019 Mar;111:813-820. doi: 10.1016/j.biopha.2018.12.062. Epub 2019 Jan 4.
• [8] Prognostic and predictive value of HURP in nonsmall cell lung cancer.Oncol Rep. 2018 Apr;39(4):1682-1692. doi: 10.3892/or.2018.6280. Epub 2018 Feb 26.
• [9] Potential molecular marker for detecting transitional cell carcinoma.Urology. 2002 Jul;60(1):181-5. doi: 10.1016/s0090-4295(02)01672-2.
• [10] Prognostic value of DLGAP5 in colorectal cancer.Int J Colorectal Dis. 2019 Aug;34(8):1455-1465. doi: 10.1007/s00384-019-03339-6. Epub 2019 Jul 8.
• [11] DAP-5 is involved in MycN/IFNgamma-induced apoptosis in human neuroblastoma cells.Cancer Lett. 2001 Jan 26;162(2):237-43. doi: 10.1016/s0304-3835(00)00644-3.
• [12] Genome-scale analysis identifies NEK2, DLGAP5 and ECT2 as promising diagnostic and prognostic biomarkers in human lung cancer.Sci Rep. 2017 Aug 14;7(1):8072. doi: 10.1038/s41598-017-08615-5.
• [13] Evaluation of urinary HURP mRNA as a marker for detection of bladder cancer: relation to bilharziasis.Med Oncol. 2014 Feb;31(2):804. doi: 10.1007/s12032-013-0804-4. Epub 2013 Dec 28.
• [14] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [15] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [16] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [17] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [18] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [19] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [20] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [21] Global gene expression profiles induced by phytoestrogens in human breast cancer cells. Endocr Relat Cancer. 2008 Mar;15(1):161-73.
• [22] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [23] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [24] Time series analysis of oxidative stress response patterns in HepG2: a toxicogenomics approach. Toxicology. 2013 Apr 5;306:24-34.
• [25] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [26] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [27] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [28] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [29] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [30] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [31] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [32] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [33] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [34] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [35] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [36] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [37] Methamphetamine alters the normal progression by inducing cell cycle arrest in astrocytes. PLoS One. 2014 Oct 7;9(10):e109603.
• [38] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [39] A high concentration of genistein down-regulates activin A, Smad3 and other TGF-beta pathway genes in human uterine leiomyoma cells. Exp Mol Med. 2012 Apr 30;44(4):281-92.
• [40] Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
• [41] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [42] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [43] In silico, in vitro and in vivo studies: Dibutyl phthalate promotes prostate cancer cell proliferation by activating Forkhead Box M1 and remission after Natura- pretreatment. Toxicology. 2023 Apr;488:153465. doi: 10.1016/j.tox.2023.153465. Epub 2023 Feb 23.
• [44] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [45] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [46] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [47] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [48] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [49] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [50] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [51] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.