Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXFP98E)

DOT Name Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 (B3GAT1)
Synonyms EC 2.4.1.135; Beta-1,3-glucuronyltransferase 1; Glucuronosyltransferase P; GlcAT-P; UDP-GlcUA:glycoprotein beta-1,3-glucuronyltransferase; GlcUAT-P
Gene Name B3GAT1
Related Disease
Parkinson disease ( )
Alzheimer disease ( )
Asthma ( )
Carcinoma ( )
Clear cell renal carcinoma ( )
Colorectal carcinoma ( )
Depression ( )
Familial prostate carcinoma ( )
High blood pressure ( )
Influenza ( )
Large granular lymphocytic leukemia ( )
Leukemia ( )
Lung cancer ( )
Lung carcinoma ( )
Neuroblastoma ( )
Neuroendocrine neoplasm ( )
Non-alcoholic fatty liver disease ( )
Non-alcoholic steatohepatitis ( )
Non-small-cell lung cancer ( )
Osteoarthritis ( )
Plasma cell myeloma ( )
Primary biliary cholangitis ( )
Prostate cancer, hereditary, 1 ( )
Prostate carcinoma ( )
Prostate neoplasm ( )
Pulmonary fibrosis ( )
Renal cell carcinoma ( )
Rheumatoid arthritis ( )
Schizophrenia ( )
Squamous cell carcinoma ( )
HIV infectious disease ( )
leukaemia ( )
Neoplasm ( )
Melanoma ( )
Acute lymphocytic leukaemia ( )
Adult glioblastoma ( )
Advanced cancer ( )
Autoimmune lymphoproliferative syndrome type 1 ( )
Breast cancer ( )
Breast carcinoma ( )
Childhood acute lymphoblastic leukemia ( )
Chronic kidney disease ( )
Complex regional pain syndrome ( )
Cytomegalovirus infection ( )
Glioblastoma multiforme ( )
Hepatitis C virus infection ( )
UniProt ID
B3GA1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1V82; 1V83; 1V84
EC Number
2.4.1.135
Pfam ID
PF03360
Sequence
MPKRRDILAIVLIVLPWTLLITVWHQSTLAPLLAVHKDEGSDPRRETPPGADPREYCTSD
RDIVEVVRTEYVYTRPPPWSDTLPTIHVVTPTYSRPVQKAELTRMANTLLHVPNLHWLVV
EDAPRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRET
FPRNSSQPGVVYFADDDNTYSLELFEEMRSTRRVSVWPVAFVGGLRYEAPRVNGAGKVVG
WKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLRGVKGGYQESSLLRELVTLNDLEPK
AANCTKILVWHTRTEKPVLVNEGKKGFTDPSVEI
Function
Involved in the biosynthesis of L2/HNK-1 carbohydrate epitope on glycoproteins. Can also play a role in glycosaminoglycan biosynthesis. Substrates include asialo-orosomucoid (ASOR), asialo-fetuin, and asialo-neural cell adhesion molecule. Requires sphingomyelin for activity: stearoyl-sphingomyelin was the most effective, followed by palmitoyl-sphingomyelin and lignoceroyl-sphingomyelin. Activity was demonstrated only for sphingomyelin with a saturated fatty acid and not for that with an unsaturated fatty acid, regardless of the length of the acyl group.
Tissue Specificity Mainly expressed in the brain.
KEGG Pathway
Mannose type O-glycan biosynthesis (hsa00515 )
Metabolic pathways (hsa01100 )
Reactome Pathway
A tetrasaccharide linker sequence is required for GAG synthesis (R-HSA-1971475 )
BioCyc Pathway
MetaCyc:HS03272-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Parkinson disease DISQVHKL Definitive Altered Expression [1]
Alzheimer disease DISF8S70 Strong Altered Expression [2]
Asthma DISW9QNS Strong Biomarker [3]
Carcinoma DISH9F1N Strong Genetic Variation [4]
Clear cell renal carcinoma DISBXRFJ Strong Biomarker [5]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [6]
Depression DIS3XJ69 Strong Biomarker [7]
Familial prostate carcinoma DISL9KNO Strong Biomarker [8]
High blood pressure DISY2OHH Strong Biomarker [9]
Influenza DIS3PNU3 Strong Biomarker [10]
Large granular lymphocytic leukemia DISHOPPI Strong Biomarker [11]
Leukemia DISNAKFL Strong Biomarker [12]
Lung cancer DISCM4YA Strong Altered Expression [13]
Lung carcinoma DISTR26C Strong Altered Expression [13]
Neuroblastoma DISVZBI4 Strong Altered Expression [2]
Neuroendocrine neoplasm DISNPLOO Strong Altered Expression [14]
Non-alcoholic fatty liver disease DISDG1NL Strong Biomarker [15]
Non-alcoholic steatohepatitis DIST4788 Strong Biomarker [15]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [16]
Osteoarthritis DIS05URM Strong Altered Expression [17]
Plasma cell myeloma DIS0DFZ0 Strong Biomarker [18]
Primary biliary cholangitis DIS43E0O Strong Biomarker [19]
Prostate cancer, hereditary, 1 DISE2P4L Strong Biomarker [8]
Prostate carcinoma DISMJPLE Strong Genetic Variation [8]
Prostate neoplasm DISHDKGQ Strong Biomarker [20]
Pulmonary fibrosis DISQKVLA Strong Biomarker [21]
Renal cell carcinoma DISQZ2X8 Strong Biomarker [5]
Rheumatoid arthritis DISTSB4J Strong Altered Expression [17]
Schizophrenia DISSRV2N Strong Biomarker [22]
Squamous cell carcinoma DISQVIFL Strong Biomarker [23]
HIV infectious disease DISO97HC moderate Altered Expression [24]
leukaemia DISS7D1V moderate Biomarker [12]
Neoplasm DISZKGEW moderate Altered Expression [25]
Melanoma DIS1RRCY Disputed Altered Expression [26]
Acute lymphocytic leukaemia DISPX75S Limited Biomarker [27]
Adult glioblastoma DISVP4LU Limited Altered Expression [28]
Advanced cancer DISAT1Z9 Limited Biomarker [29]
Autoimmune lymphoproliferative syndrome type 1 DISAFGRA Limited Biomarker [30]
Breast cancer DIS7DPX1 Limited Biomarker [31]
Breast carcinoma DIS2UE88 Limited Biomarker [31]
Childhood acute lymphoblastic leukemia DISJ5D6U Limited Biomarker [27]
Chronic kidney disease DISW82R7 Limited Biomarker [32]
Complex regional pain syndrome DIS625IE Limited Altered Expression [33]
Cytomegalovirus infection DISCEMGC Limited Altered Expression [34]
Glioblastoma multiforme DISK8246 Limited Altered Expression [28]
Hepatitis C virus infection DISQ0M8R Limited Biomarker [35]
------------------------------------------------------------------------------------
⏷ Show the Full List of 46 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 (B3GAT1). [36]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 (B3GAT1). [39]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 (B3GAT1). [41]
------------------------------------------------------------------------------------
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 (B3GAT1). [37]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 (B3GAT1). [38]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 (B3GAT1). [38]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 (B3GAT1). [40]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 (B3GAT1). [42]
Deguelin DMXT7WG Investigative Deguelin decreases the expression of Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 (B3GAT1). [43]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Abnormalities of age-related T cell senescence in Parkinson's disease.J Neuroinflammation. 2018 May 28;15(1):166. doi: 10.1186/s12974-018-1206-5.
2 HNK-1 Carrier Glycoproteins Are Decreased in the Alzheimer's Disease Brain.Mol Neurobiol. 2017 Jan;54(1):188-199. doi: 10.1007/s12035-015-9644-x. Epub 2016 Jan 6.
3 Hydrogen sulfide and substance P in inflammation.Antioxid Redox Signal. 2010 May 15;12(10):1191-202. doi: 10.1089/ars.2009.2927.
4 Neuroendocrine marker expression in thyroid epithelial tumors.Endocr Pathol. 2001 Fall;12(3):291-9. doi: 10.1385/ep:12:3:291.
5 Superior antitumor in vitro responses of allogeneic matched sibling compared with autologous patient CD8+ T cells.Cancer Res. 2006 Dec 1;66(23):11447-54. doi: 10.1158/0008-5472.CAN-06-0998.
6 The NK1 receptor antagonist NKP608 inhibits proliferation of human colorectal cancer cells via Wnt signaling pathway.Biol Res. 2018 May 30;51(1):14. doi: 10.1186/s40659-018-0163-x.
7 NK1 receptor antagonists for depression: Why a validated concept was abandoned.J Affect Disord. 2017 Dec 1;223:121-125. doi: 10.1016/j.jad.2017.07.042. Epub 2017 Jul 20.
8 Association analyses of more than 140,000 men identify 63 new prostate cancer susceptibility loci.Nat Genet. 2018 Jul;50(7):928-936. doi: 10.1038/s41588-018-0142-8. Epub 2018 Jun 11.
9 Causal association between periodontitis and hypertension: evidence from Mendelian randomization and a randomized controlled trial of non-surgical periodontal therapy.Eur Heart J. 2019 Nov 1;40(42):3459-3470. doi: 10.1093/eurheartj/ehz646.
10 Diminished effector and memory CD8+ circulating T lymphocytes in patients with severe influenza caused by the AH1N1 pdm09 virus.Virology. 2017 Jan;500:139-148. doi: 10.1016/j.virol.2016.10.016. Epub 2016 Nov 2.
11 Refining the diagnosis of T-cell large granular lymphocytic leukemia by combining distinct patterns of antigen expression with T-cell clonality studies.Leukemia. 2011 Sep;25(9):1439-43. doi: 10.1038/leu.2011.107. Epub 2011 May 27.
12 Dasatinib-induced anti-leukemia cellular immunity through a novel subset of CD57 positive helper/cytotoxic CD4 T cells in chronic myelogenous leukemia patients.Int J Hematol. 2018 Dec;108(6):588-597. doi: 10.1007/s12185-018-2517-0. Epub 2018 Aug 27.
13 Neural cell adhesion molecule expression and messenger RNA splicing patterns in lung cancer cell lines are correlated with neuroendocrine phenotype and growth morphology.Cancer Res. 1991 Nov 15;51(22):6142-9.
14 Different patterns of chromogranin A and Leu-7 (CD57) expression in gastrointestinal carcinoids: immunohistochemical and confocal laser scanning microscopy study.Neoplasma. 2003;50(1):1-7.
15 CYP2E1-dependent and leptin-mediated hepatic CD57 expression on CD8+ T cells aid progression of environment-linked nonalcoholic steatohepatitis.Toxicol Appl Pharmacol. 2014 Jan 1;274(1):42-54. doi: 10.1016/j.taap.2013.10.029. Epub 2013 Nov 7.
16 High OX-40 expression in the tumor immune infiltrate is a favorable prognostic factor of overall survival in non-small cell lung cancer.J Immunother Cancer. 2019 Dec 16;7(1):351. doi: 10.1186/s40425-019-0827-2.
17 Substance P receptor (NK1) gene expression in synovial tissue in rheumatoid arthritis and osteoarthritis.Scand J Rheumatol. 1998;27(2):135-41. doi: 10.1080/030097498441010.
18 Host-related immunodeficiency in the development of multiple myeloma.Leuk Lymphoma. 2018 May;59(5):1127-1132. doi: 10.1080/10428194.2017.1361026. Epub 2017 Aug 9.
19 Fine phenotypic and functional characterization of effector cluster of differentiation 8 positive T cells in human patients with primary biliary cirrhosis.Hepatology. 2011 Oct;54(4):1293-302. doi: 10.1002/hep.24526.
20 Analysis and sorting of prostate cancer cell types by flow cytometry.Prostate. 1999 Aug 1;40(3):192-9. doi: 10.1002/(sici)1097-0045(19990801)40:3<192::aid-pros7>3.0.co;2-f.
21 Glycosyltransferases and glycosaminoglycans in bleomycin and transforming growth factor-1-induced pulmonary fibrosis.Am J Respir Cell Mol Biol. 2014 Mar;50(3):583-94. doi: 10.1165/rcmb.2012-0226OC.
22 Candidate gene analysis of the human natural killer-1 carbohydrate pathway and perineuronal nets in schizophrenia: B3GAT2 is associated with disease risk and cortical surface area.Biol Psychiatry. 2011 Jan 1;69(1):90-6. doi: 10.1016/j.biopsych.2010.07.035. Epub 2010 Oct 15.
23 Evaluation of Cd8+ and natural killer cells defense in oral and oropharyngeal squamous cell carcinoma.J Craniomaxillofac Surg. 2019 Apr;47(4):676-681. doi: 10.1016/j.jcms.2019.01.036. Epub 2019 Feb 1.
24 Higher Body Mass Index Is Associated With Greater Proportions of Effector CD8+ T Cells Expressing CD57 in Women Living With HIV.J Acquir Immune Defic Syndr. 2017 Aug 15;75(5):e132-e141. doi: 10.1097/QAI.0000000000001376.
25 Live Cell Imaging Supports a Key Role for Histone Deacetylase as a Molecular Target during Glioblastoma Malignancy Downgrade through Tumor Competence Modulation.J Oncol. 2019 Aug 8;2019:9043675. doi: 10.1155/2019/9043675. eCollection 2019.
26 Human hemokinin-1 promotes migration of melanoma cells and increases MMP-2 and MT1-MMP expression by activating tumor cell NK1 receptors.Peptides. 2016 Sep;83:8-15. doi: 10.1016/j.peptides.2016.07.004. Epub 2016 Jul 22.
27 The NK-1 receptor is expressed in human leukemia and is involved in the antitumor action of aprepitant and other NK-1 receptor antagonists on acute lymphoblastic leukemia cell lines.Invest New Drugs. 2012 Apr;30(2):529-40. doi: 10.1007/s10637-010-9594-0. Epub 2010 Dec 1.
28 Application of Neurokinin-1 Receptor in Targeted Strategies for Glioma Treatment. Part I: Synthesis and Evaluation of Substance P Fragments Labeled with (99m)Tc and (177)Lu as Potential Receptor Radiopharmaceuticals.Molecules. 2018 Oct 5;23(10):2542. doi: 10.3390/molecules23102542.
29 Biphasic squamoid alveolar renal carcinoma with positive CD57 expression: A clinicopathologic study of three cases.Pathol Int. 2019 Sep;69(9):519-525. doi: 10.1111/pin.12844. Epub 2019 Aug 1.
30 FAS gene mutation in a case of autoimmune lymphoproliferative syndrome type IA with accumulation of gammadelta+ T cells.Am J Surg Pathol. 2003 Apr;27(4):546-53. doi: 10.1097/00000478-200304000-00017.
31 The neurokinin-1 receptor antagonist aprepitant is a promising candidate for the treatment of breast cancer.Int J Oncol. 2014 Oct;45(4):1658-72. doi: 10.3892/ijo.2014.2565. Epub 2014 Jul 28.
32 Uraemia-induced immune senescence and clinical outcomes in chronic kidney disease patients.Nephrol Dial Transplant. 2020 Apr 1;35(4):624-632. doi: 10.1093/ndt/gfy276.
33 Anti-allodynic effect of interleukin 10 in a mouse model of complex regional pain syndrome through reduction of NK1 receptor expression of microglia in the spinal cord.J Pain Res. 2018 Sep 4;11:1729-1741. doi: 10.2147/JPR.S166624. eCollection 2018.
34 Early KLRG1(+) but Not CD57(+)CD8(+) T Cells in Primary Cytomegalovirus Infection Predict Effector Function and Viral Control.J Immunol. 2019 Oct 15;203(8):2063-2075. doi: 10.4049/jimmunol.1900399. Epub 2019 Sep 25.
35 Augmentation of hepatitis C virus-specific immunity and sustained virologic response.J Viral Hepat. 2017 Sep;24(9):742-749. doi: 10.1111/jvh.12702. Epub 2017 May 4.
36 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
37 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
38 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
39 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
40 Bromodomain and extraterminal inhibition blocks tumor progression and promotes differentiation in?neuroblastoma. Surgery. 2015 Sep;158(3):819-26. doi: 10.1016/j.surg.2015.04.017. Epub 2015 Jun 9.
41 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
42 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
43 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.