Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXOQHE0)

• DOT Name: Kinesin-like protein KIF20A (KIF20A)
• Synonyms: GG10_2; Mitotic kinesin-like protein 2; MKlp2; Rab6-interacting kinesin-like protein; Rabkinesin-6
• Gene Name: KIF20A
• Related Disease:
  Advanced cancer
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Cardiomyopathy
  Cervical cancer
  Cervical carcinoma
  Charcot-Marie-Tooth disease type 4C
  Colorectal carcinoma
  Epithelial ovarian cancer
  Gastric cancer
  Glioma
  Hepatocellular carcinoma
  Lung adenocarcinoma
  Lung cancer
  Lung carcinoma
  Matthew-Wood syndrome
  Melanocytic nevus
  Melanoma
  Myeloid leukaemia
  Neoplasm
  Non-small-cell lung cancer
  Osteoarthritis
  Ovarian neoplasm
  Pancreatic cancer
  Pancreatic tumour
  Prostate cancer
  Prostate carcinoma
  Stomach cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Obsolete familial isolated restrictive cardiomyopathy
  Cardiomyopathy, familial restrictive, 6
  Clear cell adenocarcinoma
  Clear cell renal carcinoma
  Human papillomavirus infection
  Malignant tumor of nasopharynx
  Meningioma
  Nasopharyngeal carcinoma
• UniProt ID: KI20A_HUMAN
• PDB ID: 6YIP
• Pfam ID: PF00225
• Sequence:
  MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSED
  SMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHR
  FTFSQIFGPEVGQASFFNLTVKEMVKDVLKGQNWLIYTYGVTNSGKTHTIQGTIKDGGIL
  PRSLALIFNSLQGQLHPTPDLKPLLSNEVIWLDSKQIRQEEMKKLSLLNGGLQEEELSTS
  LKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDETSHRWAQPDTAPLPVPANIRFS
  IWISFFEIYNELLYDLLEPPSQQRKRQTLRLCEDQNGNPYVKDLNWIHVQDAEEAWKLLK
  VGRKNQSFASTHLNQNSSRSHSIFSIRILHLQGEGDIVPKISELSLCDLAGSERCKDQKS
  GERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLVPFRDSKLTRVFQGFFTGRGRSCM
  IVNVNPCASTYDETLHVAKFSAIASQLVHAPPMQLGFPSLHSFIKEHSLQVSPSLEKGAK
  ADTGLDDDIENEADISMYGKEELLQVVEAMKTLLLKERQEKLQLEMHLRDEICNEMVEQM
  QQREQWCSEHLDTQKELLEEMYEEKLNILKESLTSFYQEEIQERDEKIEELEALLQEARQ
  QSVAHQQSGSELALRRSQRLAASASTQQLQEVKAKLQQCKAELNSTTEELHKYQKMLEPP
  PSAKPFTIDVDKKLEEGQKNIRLLRTELQKLGESLQSAERACCHSTGAGKLRQALTTCDD
  ILIKQDQTLAELQNNMVLVKLDLRKKAACIAEQYHTVLKLQGQVSAKKRLGTNQENQQPN
  QQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRRSPLLKSGPFGKKY
• Function: Mitotic kinesin required for chromosome passenger complex (CPC)-mediated cytokinesis. Following phosphorylation by PLK1, involved in recruitment of PLK1 to the central spindle. Interacts with guanosine triphosphate (GTP)-bound forms of RAB6A and RAB6B. May act as a motor required for the retrograde RAB6 regulated transport of Golgi membranes and associated vesicles along microtubules. Has a microtubule plus end-directed motility.
• KEGG Pathway: Motor proteins (hsa04814)
• Reactome Pathway:
  COPI-dependent Golgi-to-ER retrograde traffic (R-HSA-6811434)
  Mitotic Telophase/Cytokinesis (R-HSA-68884)
  Kinesins (R-HSA-983189)
  MHC class II antigen presentation (R-HSA-2132295)

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Bladder cancer	DISUHNM0	Strong	Biomarker	[2]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[3]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[3]
Cardiomyopathy	DISUPZRG	Strong	Biomarker	[4]
Cervical cancer	DISFSHPF	Strong	Biomarker	[5]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[5]
Charcot-Marie-Tooth disease type 4C	DIS0SF7F	Strong	Genetic Variation	[6]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[7]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[8]
Gastric cancer	DISXGOUK	Strong	Biomarker	[9]
Glioma	DIS5RPEH	Strong	Biomarker	[10]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[11]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[12]
Lung cancer	DISCM4YA	Strong	Biomarker	[1]
Lung carcinoma	DISTR26C	Strong	Biomarker	[1]
Matthew-Wood syndrome	DISA7HR7	Strong	Altered Expression	[13]
Melanocytic nevus	DISYS32D	Strong	Altered Expression	[14]
Melanoma	DIS1RRCY	Strong	Biomarker	[14]
Myeloid leukaemia	DISMN944	Strong	Biomarker	[15]
Neoplasm	DISZKGEW	Strong	Altered Expression	[16]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[1]
Osteoarthritis	DIS05URM	Strong	Biomarker	[17]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[18]
Pancreatic cancer	DISJC981	Strong	Biomarker	[19]
Pancreatic tumour	DIS3U0LK	Strong	Biomarker	[13]
Prostate cancer	DISF190Y	Strong	Biomarker	[20]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[20]
Stomach cancer	DISKIJSX	Strong	Biomarker	[9]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[2]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[2]
Obsolete familial isolated restrictive cardiomyopathy	DIS51KNV	Supportive	Autosomal dominant	[4]
Cardiomyopathy, familial restrictive, 6	DISMY6LA	Limited	Unknown	[4]
Clear cell adenocarcinoma	DISYUGHZ	Limited	Altered Expression	[21]
Clear cell renal carcinoma	DISBXRFJ	Limited	Biomarker	[22]
Human papillomavirus infection	DISX61LX	Limited	Altered Expression	[23]
Malignant tumor of nasopharynx	DISTGIGF	Limited	Altered Expression	[24]
Meningioma	DISPT4TG	Limited	Biomarker	[25]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Altered Expression	[24]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Vinblastine	DM5TVS3	Approved	Kinesin-like protein KIF20A (KIF20A) affects the response to substance of Vinblastine.	[66]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Kinesin-like protein KIF20A (KIF20A).	[26]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Kinesin-like protein KIF20A (KIF20A).	[61]

47 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[27]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[28]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[29]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[30]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[31]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[32]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[33]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[34]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[35]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Kinesin-like protein KIF20A (KIF20A).	[36]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Kinesin-like protein KIF20A (KIF20A).	[37]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[38]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[38]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Kinesin-like protein KIF20A (KIF20A).	[39]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[40]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[41]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[42]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[43]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[44]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[45]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[46]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[32]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[47]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Kinesin-like protein KIF20A (KIF20A).	[48]
Mitomycin	DMH0ZJE	Approved	Mitomycin decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[32]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[49]
Methamphetamine	DMPM4SK	Approved	Methamphetamine decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[50]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[51]
Bicalutamide	DMZMSPF	Approved	Bicalutamide decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[52]
Colchicine	DM2POTE	Approved	Colchicine decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[32]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[32]
Adenine	DMZLHKJ	Approved	Adenine decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[32]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Kinesin-like protein KIF20A (KIF20A).	[53]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Kinesin-like protein KIF20A (KIF20A).	[54]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[55]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[43]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[56]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[57]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[58]
TAK-114	DMTXE19	Phase 1	TAK-114 decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[59]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[60]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[62]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Kinesin-like protein KIF20A (KIF20A).	[63]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Kinesin-like protein KIF20A (KIF20A).	[54]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Kinesin-like protein KIF20A (KIF20A).	[64]
Dibutyl phthalate	DMEDGKO	Investigative	Dibutyl phthalate increases the expression of Kinesin-like protein KIF20A (KIF20A).	[59]
Choline	DM5D9YK	Investigative	Choline affects the expression of Kinesin-like protein KIF20A (KIF20A).	[65]

References

• [1] KIF20A silence inhibits the migration, invasion and proliferation of non-small cell lung cancer and regulates the JNK pathway.Clin Exp Pharmacol Physiol. 2020 Jan;47(1):135-142. doi: 10.1111/1440-1681.13183. Epub 2019 Oct 22.
• [2] Role of a Kinesin Motor in Cancer Cell Mechanics.Nano Lett. 2019 Nov 13;19(11):7691-7702. doi: 10.1021/acs.nanolett.9b02592. Epub 2019 Oct 7.
• [3] Paclitaxel targets FOXM1 to regulate KIF20A in mitotic catastrophe and breast cancer paclitaxel resistance.Oncogene. 2016 Feb 25;35(8):990-1002. doi: 10.1038/onc.2015.152. Epub 2015 May 11.
• [4] Compound heterozygous loss-of-function mutations in KIF20A are associated with a novel lethal congenital cardiomyopathy in two siblings. PLoS Genet. 2018 Jan 22;14(1):e1007138. doi: 10.1371/journal.pgen.1007138. eCollection 2018 Jan.
• [5] Upregulated circ_0005576 facilitates cervical cancer progression via the miR-153/KIF20A axis.Biomed Pharmacother. 2019 Oct;118:109311. doi: 10.1016/j.biopha.2019.109311. Epub 2019 Aug 10.
• [6] The kinesin superfamily protein Rab6KIFL is not involved in the pathophysiology of Charcot-Marie-Tooth disease type 4C.Int J Mol Med. 2003 Jan;11(1):45-7.
• [7] KIF20A promotes cellular malignant behavior and enhances resistance to chemotherapy in colorectal cancer through regulation of the JAK/STAT3 signaling pathway.Aging (Albany NY). 2019 Dec 16;11(24):11905-11921. doi: 10.18632/aging.102505. Epub 2019 Dec 16.
• [8] Overexpression of kinesin family member 20A is associated with unfavorable clinical outcome and tumor progression in epithelial ovarian cancer.Cancer Manag Res. 2018 Sep 12;10:3433-3450. doi: 10.2147/CMAR.S169214. eCollection 2018.
• [9] Upregulation of KIF20A correlates with poor prognosis in gastric cancer.Cancer Manag Res. 2018 Nov 23;10:6205-6216. doi: 10.2147/CMAR.S176147. eCollection 2018.
• [10] MiR-876-3p targets KIF20A to block JAK2/STAT3 pathway in glioma.Am J Transl Res. 2019 Aug 15;11(8):4957-4966. eCollection 2019.
• [11] Aberrant KIF20A expression might independently predict poor overall survival and recurrence-free survival of hepatocellular carcinoma.IUBMB Life. 2018 Apr;70(4):328-335. doi: 10.1002/iub.1726. Epub 2018 Mar 2.
• [12] Overexpression of KIF20A confers malignant phenotype of lung adenocarcinoma by promoting cell proliferation and inhibiting apoptosis.Cancer Med. 2018 Sep;7(9):4678-4689. doi: 10.1002/cam4.1710. Epub 2018 Aug 13.
• [13] Down-regulation of RAB6KIFL/KIF20A, a kinesin involved with membrane trafficking of discs large homologue 5, can attenuate growth of pancreatic cancer cell.Cancer Res. 2005 Jan 1;65(1):105-12.
• [14] Kinesin family member 20A is a novel melanoma-associated antigen.Acta Derm Venereol. 2012 Nov;92(6):593-7. doi: 10.2340/00015555-1416.
• [15] cDNA cloning, expression pattern, genomic structure and chromosomal location of RAB6KIFL, a human kinesin-like gene.Gene. 2000 May 2;248(1-2):117-25. doi: 10.1016/s0378-1119(00)00135-9.
• [16] Roles and mechanisms of Kinesin-6 KIF20A in spindle organization during cell division.Eur J Cell Biol. 2019 Jun;98(2-4):74-80. doi: 10.1016/j.ejcb.2018.12.002. Epub 2018 Dec 16.
• [17] Identification of genes associated with osteoarthritis by microarray analysis.Mol Med Rep. 2015 Oct;12(4):5211-6. doi: 10.3892/mmr.2015.4048. Epub 2015 Jul 7.
• [18] Inhibition of KIF20A by BKS0349 reduces endometriotic lesions in a xenograft mouse model.Mol Hum Reprod. 2019 Sep 1;25(9):562-571. doi: 10.1093/molehr/gaz044.
• [19] Phase II clinical trial of peptide cocktail therapy for patients with advanced pancreatic cancer: VENUS-PC study.Cancer Sci. 2017 Jan;108(1):73-80. doi: 10.1111/cas.13113. Epub 2016 Dec 19.
• [20] The Identification of Potential Biomarkers and Biological Pathways in Prostate Cancer.J Cancer. 2019 Feb 23;10(6):1398-1408. doi: 10.7150/jca.29571. eCollection 2019.
• [21] KIF20A expression as a prognostic indicator and its possible involvement in the proliferation of ovarian clearcell carcinoma cells.Oncol Rep. 2018 Jul;40(1):195-205. doi: 10.3892/or.2018.6401. Epub 2018 Apr 25.
• [22] Identification of key genes involved in the metastasis of clear cell renal cell carcinoma.Oncol Lett. 2019 May;17(5):4321-4328. doi: 10.3892/ol.2019.10130. Epub 2019 Mar 8.
• [23] High Expression of KIF20A Is Associated with Poor Overall Survival and Tumor Progression in Early-Stage Cervical Squamous Cell Carcinoma.PLoS One. 2016 Dec 12;11(12):e0167449. doi: 10.1371/journal.pone.0167449. eCollection 2016.
• [24] Overexpression of Kinesin Family Member 20A Correlates with Disease Progression and Poor Prognosis in Human Nasopharyngeal Cancer: A Retrospective Analysis of 105 Patients.PLoS One. 2017 Jan 12;12(1):e0169280. doi: 10.1371/journal.pone.0169280. eCollection 2017.
• [25] Identification of KIF11 As a Novel Target in Meningioma.Cancers (Basel). 2019 Apr 15;11(4):545. doi: 10.3390/cancers11040545.
• [26] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [27] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [28] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [29] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [30] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [31] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [32] Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
• [33] Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
• [34] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [35] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [36] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [37] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [38] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [39] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [40] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [41] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [42] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [43] Comparative gene expression profiling reveals partially overlapping but distinct genomic actions of different antiestrogens in human breast cancer cells. J Cell Biochem. 2006 Aug 1;98(5):1163-84.
• [44] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [45] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [46] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [47] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [48] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [49] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [50] Methamphetamine alters the normal progression by inducing cell cycle arrest in astrocytes. PLoS One. 2014 Oct 7;9(10):e109603.
• [51] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [52] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [53] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [54] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [55] Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
• [56] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [57] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [58] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [59] In silico, in vitro and in vivo studies: Dibutyl phthalate promotes prostate cancer cell proliferation by activating Forkhead Box M1 and remission after Natura- pretreatment. Toxicology. 2023 Apr;488:153465. doi: 10.1016/j.tox.2023.153465. Epub 2023 Feb 23.
• [60] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [61] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [62] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [63] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [64] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [65] Lymphocyte gene expression in subjects fed a low-choline diet differs between those who develop organ dysfunction and those who do not. Am J Clin Nutr. 2007 Jul;86(1):230-9. doi: 10.1093/ajcn/86.1.230.
• [66] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.