Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXSSY4H)

• DOT Name: Chromatin assembly factor 1 subunit A (CHAF1A)
• Synonyms: CAF-1 subunit A; Chromatin assembly factor I p150 subunit; CAF-I 150 kDa subunit; CAF-I p150; hp150
• Gene Name: CHAF1A
• Related Disease:
  Glioma
  Advanced cancer
  Amyotrophic lateral sclerosis
  Atrial fibrillation
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Carcinoma
  Carcinoma of esophagus
  Cervical carcinoma
  Colon cancer
  Colon carcinoma
  Epithelial ovarian cancer
  Esophageal cancer
  Esophageal squamous cell carcinoma
  Frontotemporal dementia
  Hepatitis B virus infection
  Metastatic malignant neoplasm
  Neoplasm of esophagus
  Neuroblastoma
  Non-small-cell lung cancer
  Obesity
  Ovarian cancer
  Ovarian neoplasm
  Prostate neoplasm
  Renal cell carcinoma
  rubella
  Squamous cell carcinoma
  Systemic lupus erythematosus
  Urinary bladder cancer
  Adult glioblastoma
  Gastric cancer
  Glioblastoma multiforme
  Laryngeal carcinoma
  Laryngeal squamous cell carcinoma
  Stomach cancer
  Multiple sclerosis
  Carcinoma of liver and intrahepatic biliary tract
  Cutaneous melanoma
  Liver cancer
  Mouth disorder
  Neoplasm
  Parkinsonian disorder
  Type-1/2 diabetes
  Urinary bladder neoplasm
• UniProt ID: CAF1A_HUMAN
• PDB ID: 7Y5K; 7Y5L; 7Y5O; 7Y5U; 7Y5V; 7Y60; 7Y61; 8IQF; 8IQG; 8J6S; 8J6T
• Pfam ID: PF11600 ; PF15539 ; PF15557 ; PF12253
• Sequence:
  MLEELECGAPGARGAATAMDCKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTS
  VQSKSPDLEASLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLT
  EDSNEQPDSLVDHNKLNSEASPSREAINGQREDTGDQQGLLKAIQNDKLAFPGETLSDIP
  CKTEEEGVGCGGAGRRGDSQECSPRSCPELTSGPRMCPRKEQDSWSEAGGILFKGKVPMV
  VLQDILAVRPPQIKSLPATPQGKNMTPESEVLESFPEEDSVLSHSSLSSPSSTSSPEGPP
  APPKQHSSTSPFPTSTPLRRITKKFVKGSTEKNKLRLQRDQERLGKQLKLRAEREEKEKL
  KEEAKRAKEEAKKKKEEEKELKEKERREKREKDEKEKAEKQRLKEERRKERQEALEAKLE
  EKRKKEEEKRLREEEKRIKAEKAEITRFFQKPKTPQAPKTLAGSCGKFAPFEIKEHMVLA
  PRRRTAFHPDLCSQLDQLLQQQSGEFSFLKDLKGRQPLRSGPTHVSTRNADIFNSDVVIV
  ERGKGDGVPERRKFGRMKLLQFCENHRPAYWGTWNKKTALIRARDPWAQDTKLLDYEVDS
  DEEWEEEEPGESLSHSEGDDDDDMGEDEDEDDGFFVPHGYLSEDEGVTEECADPENHKVR
  QKLKAKEWDEFLAKGKRFRVLQPVKIGCVWAADRDCAGDDLKVLQQFAACFLETLPAQEE
  QTPKASKRERRDEQILAQLLPLLHGNVNGSKVIIREFQEHCRRGLLSNHTGSPRSPSTTY
  LHTPTPSEDAAIPSKSRLKRLISENSVYEKRPDFRMCWYVHPQVLQSFQQEHLPVPCQWS
  YVTSVPSAPKEDSGSVPSTGPSQGTPISLKRKSAGSMCITQFMKKRRHDGQIGAEDMDGF
  QADTEEEEEEEGDCMIVDVPDAAEVQAPCGAASGAGGGVGVDTGKATLTASPLGAS
• Function: Core component of the CAF-1 complex, a complex that is thought to mediate chromatin assembly in DNA replication and DNA repair. Assembles histone octamers onto replicating DNA in vitro. CAF-1 performs the first step of the nucleosome assembly process, bringing newly synthesized histones H3 and H4 to replicating DNA; histones H2A/H2B can bind to this chromatin precursor subsequent to DNA replication to complete the histone octamer. It may play a role in heterochromatin maintenance in proliferating cells by bringing newly synthesized cbx proteins to heterochromatic DNA replication foci.

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Glioma	DIS5RPEH	Definitive	Genetic Variation	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Genetic Variation	[3]
Atrial fibrillation	DIS15W6U	Strong	Genetic Variation	[4]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[5]
Breast cancer	DIS7DPX1	Strong	Biomarker	[6]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[6]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[7]
Carcinoma	DISH9F1N	Strong	Biomarker	[8]
Carcinoma of esophagus	DISS6G4D	Strong	Biomarker	[9]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[10]
Colon cancer	DISVC52G	Strong	Altered Expression	[11]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[11]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[12]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[9]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[13]
Frontotemporal dementia	DISKYHXL	Strong	Genetic Variation	[3]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[14]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[10]
Neoplasm of esophagus	DISOLKAQ	Strong	Biomarker	[9]
Neuroblastoma	DISVZBI4	Strong	Biomarker	[15]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[16]
Obesity	DIS47Y1K	Strong	Biomarker	[17]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[18]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[18]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[19]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[8]
rubella	DISXUI9P	Strong	Biomarker	[20]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[21]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[22]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[5]
Adult glioblastoma	DISVP4LU	moderate	Biomarker	[23]
Gastric cancer	DISXGOUK	moderate	Biomarker	[24]
Glioblastoma multiforme	DISK8246	moderate	Biomarker	[23]
Laryngeal carcinoma	DISNHCIV	moderate	Genetic Variation	[25]
Laryngeal squamous cell carcinoma	DIS9UUVF	moderate	Altered Expression	[25]
Stomach cancer	DISKIJSX	moderate	Biomarker	[24]
Multiple sclerosis	DISB2WZI	Disputed	Biomarker	[3]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Biomarker	[26]
Cutaneous melanoma	DIS3MMH9	Limited	Biomarker	[27]
Liver cancer	DISDE4BI	Limited	Biomarker	[26]
Mouth disorder	DISX82BI	Limited	Biomarker	[28]
Neoplasm	DISZKGEW	Limited	Biomarker	[13]
Parkinsonian disorder	DISHGY45	Limited	Biomarker	[29]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[30]
Urinary bladder neoplasm	DIS7HACE	Limited	Altered Expression	[5]

25 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[31]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[32]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[33]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[34]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[35]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[38]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[39]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[39]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[40]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[41]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[42]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[43]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[35]
Mitomycin	DMH0ZJE	Approved	Mitomycin decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[35]
Colchicine	DM2POTE	Approved	Colchicine decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[35]
Adenine	DMZLHKJ	Approved	Adenine decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[35]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[44]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[45]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[46]
Arecoline	DMFJZK3	Phase 1	Arecoline decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[28]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[48]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[49]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[50]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[51]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Chromatin assembly factor 1 subunit A (CHAF1A).	[52]

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Chromatin assembly factor 1 subunit A (CHAF1A).	[36]
Quercetin	DM3NC4M	Approved	Quercetin decreases the phosphorylation of Chromatin assembly factor 1 subunit A (CHAF1A).	[37]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Chromatin assembly factor 1 subunit A (CHAF1A).	[37]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Chromatin assembly factor 1 subunit A (CHAF1A).	[37]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the phosphorylation of Chromatin assembly factor 1 subunit A (CHAF1A).	[53]

References

• [1] Comprehensive analysis of the role of DNA repair gene polymorphisms on risk of glioma.Hum Mol Genet. 2008 Mar 15;17(6):800-5. doi: 10.1093/hmg/ddm351. Epub 2007 Nov 29.
• [2] Phenotypic Plasticity of Fibroblasts during Mammary Carcinoma Development.Int J Mol Sci. 2019 Sep 9;20(18):4438. doi: 10.3390/ijms20184438.
• [3] The p150 subunit of dynactin (DCTN1) gene in multiple sclerosis.Acta Neurol Scand. 2007 Oct;116(4):231-4. doi: 10.1111/j.1600-0404.2007.00884.x.
• [4] Expression and activity of ectopeptidases in fibrillating human atria.J Mol Cell Cardiol. 2001 Jun;33(6):1273-81. doi: 10.1006/jmcc.2001.1389.
• [5] Cancer-associated fibroblasts induce epithelial-mesenchymal transition of bladder cancer cells through paracrine IL-6 signalling.BMC Cancer. 2019 Feb 11;19(1):137. doi: 10.1186/s12885-019-5353-6.
• [6] Calendula arvensis L. as an anti-cancer agent against breast cancer cell lines.Mol Biol Rep. 2019 Apr;46(2):2187-2196. doi: 10.1007/s11033-019-04672-3. Epub 2019 Feb 11.
• [7] Nano-Strategies to Target Breast Cancer-Associated Fibroblasts: Rearranging the Tumor Microenvironment to Achieve Antitumor Efficacy.Int J Mol Sci. 2019 Mar 13;20(6):1263. doi: 10.3390/ijms20061263.
• [8] Clinical significance and prognostic value of chromatin assembly factor-1 overexpression in human solid tumours.Histopathology. 2010 Nov;57(5):716-24. doi: 10.1111/j.1365-2559.2010.03681.x.
• [9] Cancer-associated fibroblasts (CAFs) promote the lymph node metastasis of esophageal squamous cell carcinoma.Int J Cancer. 2019 Feb 15;144(4):828-840. doi: 10.1002/ijc.31953. Epub 2018 Dec 3.
• [10] p150 overexpression in gastric carcinoma: the association with p53, apoptosis and cell proliferation.Int J Cancer. 2004 Nov 10;112(3):393-8. doi: 10.1002/ijc.20443.
• [11] Up-regulation of CHAF1A, a poor prognostic factor, facilitates cell proliferation of colon cancer.Biochem Biophys Res Commun. 2014 Jun 27;449(2):208-15. doi: 10.1016/j.bbrc.2014.05.006. Epub 2014 May 15.
• [12] Over-expression of CHAF1A in Epithelial Ovarian Cancer can promote cell proliferation and inhibit cell apoptosis.Biochem Biophys Res Commun. 2017 Apr 22;486(1):191-197. doi: 10.1016/j.bbrc.2017.03.026. Epub 2017 Mar 9.
• [13] Cancer-associated Fibroblast-promoted LncRNA DNM3OS Confers Radioresistance by Regulating DNA Damage Response in Esophageal Squamous Cell Carcinoma.Clin Cancer Res. 2019 Mar 15;25(6):1989-2000. doi: 10.1158/1078-0432.CCR-18-0773. Epub 2018 Nov 21.
• [14] Hepatitis B virus reactivation in adjuvant chemotherapy for breast cancer.Breast Cancer. 2013 Oct;20(4):367-70. doi: 10.1007/s12282-010-0213-x. Epub 2010 Jul 24.
• [15] Collaboration of cancer-associated fibroblasts and tumour-associated macrophages for neuroblastoma development.J Pathol. 2016 Oct;240(2):211-23. doi: 10.1002/path.4769. Epub 2016 Sep 19.
• [16] MiR-520b inhibited metastasis and proliferation of non-small cell lung cancer by targeting CHAF1A.Eur Rev Med Pharmacol Sci. 2018 Nov;22(22):7742-7749. doi: 10.26355/eurrev_201811_16396.
• [17] A cafeteria diet triggers intestinal inflammation and oxidative stress in obese rats.Br J Nutr. 2017 Jan;117(2):218-229. doi: 10.1017/S0007114516004608. Epub 2017 Jan 30.
• [18] Reprogramming of stromal fibroblasts by SNAI2 contributes to tumor desmoplasia and ovarian cancer progression.Mol Cancer. 2017 Oct 17;16(1):163. doi: 10.1186/s12943-017-0732-6.
• [19] Gene expression profiling predicts clinical outcome of prostate cancer.J Clin Invest. 2004 Mar;113(6):913-23. doi: 10.1172/JCI20032.
• [20] Characterization of rubella-specific humoral immunity following two doses of MMR vaccine using proteome microarray technology.PLoS One. 2017 Nov 16;12(11):e0188149. doi: 10.1371/journal.pone.0188149. eCollection 2017.
• [21] CAF-1 Subunits Levels Suggest Combined Treatments with PARP-Inhibitors and Ionizing Radiation in Advanced HNSCC.Cancers (Basel). 2019 Oct 17;11(10):1582. doi: 10.3390/cancers11101582.
• [22] Antiribonuclease H2 antibodies are an immune biomarker for systemic lupus erythematosus.Autoimmunity. 2017 Jun;50(4):241-246. doi: 10.1080/08916934.2017.1329422. Epub 2017 May 27.
• [23] Effect of cancer-associated fibroblasts on the migration of glioma cells in vitro.Tumour Biol. 2015 Aug;36(8):5873-9. doi: 10.1007/s13277-015-3259-8. Epub 2015 Feb 25.
• [24] Development of a novel gene signature in patients without Helicobacter pylori infection gastric cancer.J Cell Biochem. 2020 Feb;121(2):1842-1854. doi: 10.1002/jcb.29419. Epub 2019 Oct 21.
• [25] Overexpression of chromatin assembly factor-1/p60 predicts biological behaviour of laryngeal carcinomas.Acta Otorhinolaryngol Ital. 2017 Feb;37(1):17-24. doi: 10.14639/0392-100X-867.
• [26] Inducible factors for cancer-associated fibroblasts in liver cancer versus myofibroblasts in inflammatory liver disease.Histol Histopathol. 2016 Feb;31(2):141-8. doi: 10.14670/HH-11-668. Epub 2015 Sep 23.
• [27] Tissue microarray-based evaluation of Chromatin Assembly Factor-1 (CAF-1)/p60 as tumour prognostic marker.Int J Mol Sci. 2012;13(9):11044-11062. doi: 10.3390/ijms130911044. Epub 2012 Sep 5.
• [28] Characterization of arecoline-induced effects on cytotoxicity in normal human gingival fibroblasts by global gene expression profiling. Toxicol Sci. 2007 Nov;100(1):66-74.
• [29] The dynactin p150 subunit: cell biology studies of sequence changes found in ALS/MND and Parkinsonian syndromes.J Neural Transm (Vienna). 2013 May;120(5):785-98. doi: 10.1007/s00702-012-0910-z. Epub 2012 Nov 11.
• [30] Risk prediction in post-infarction patients with moderately reduced left ventricular ejection fraction by combined assessment of the sympathetic and vagal cardiac autonomic nervous system.Int J Cardiol. 2017 Dec 15;249:1-5. doi: 10.1016/j.ijcard.2017.06.091.
• [31] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [32] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [33] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [34] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [35] Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
• [36] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [37] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [38] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [39] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [40] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [41] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [42] Bortezomib induces caspase-dependent apoptosis in Hodgkin lymphoma cell lines and is associated with reduced c-FLIP expression: a gene expression profiling study with implications for potential combination therapies. Leuk Res. 2008 Feb;32(2):275-85. doi: 10.1016/j.leukres.2007.05.024. Epub 2007 Jul 19.
• [43] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [44] Changes in gene expressions elicited by physiological concentrations of genistein on human endometrial cancer cells. Mol Carcinog. 2006 Oct;45(10):752-63.
• [45] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [46] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [47] Characterization of arecoline-induced effects on cytotoxicity in normal human gingival fibroblasts by global gene expression profiling. Toxicol Sci. 2007 Nov;100(1):66-74.
• [48] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [49] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [50] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [51] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [52] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [53] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.