Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYP1F6J)

• DOT Name: Calnexin (CANX)
• Synonyms: IP90; Major histocompatibility complex class I antigen-binding protein p88; p90
• Gene Name: CANX
• Related Disease:
  Absence epilepsy
  Advanced cancer
  Benign prostatic hyperplasia
  Breast adenocarcinoma
  Breast carcinoma
  Central nervous system lymphoma
  Cervical Intraepithelial neoplasia
  Charcot marie tooth disease
  Gastric cancer
  Glioblastoma multiforme
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Hyperinsulinemia
  Lung adenocarcinoma
  Lyme disease
  Measles
  Multiple sclerosis
  Myocardial infarction
  Myocardial ischemia
  Nephrogenic diabetes insipidus
  Plasma cell myeloma
  Retinitis pigmentosa
  rubella
  Spinal muscular atrophy
  Stomach cancer
  Vitiligo
  Von willebrand disease
  Breast cancer
  Lung cancer
  Lung carcinoma
  Metastatic malignant neoplasm
  Tuberous sclerosis
  Arteriosclerosis
  Atherosclerosis
  Bone osteosarcoma
  Melanoma
  Metastatic melanoma
  Neoplasm
  Osteosarcoma
  Post-traumatic stress disorder
  Prostate cancer
  Prostate carcinoma
  Type-1/2 diabetes
• UniProt ID: CALX_HUMAN
• Pfam ID: PF00262
• Sequence:
  MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTY
  KAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGL
  VLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFH
  DKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTL
  ILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVK
  PDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRC
  ESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFS
  AIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEER
  PWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDE
  EEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE
• Function: Calcium-binding protein that interacts with newly synthesized monoglucosylated glycoproteins in the endoplasmic reticulum. It may act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins. Associated with partial T-cell antigen receptor complexes that escape the ER of immature thymocytes, it may function as a signaling complex regulating thymocyte maturation. Additionally it may play a role in receptor-mediated endocytosis at the synapse.
• KEGG Pathway:
  Protein processing in endoplasmic reticulum (hsa04141)
  Phagosome (hsa04145)
  Antigen processing and presentation (hsa04612)
  Thyroid hormone synthesis (hsa04918)
  Human T-cell leukemia virus 1 infection (hsa05166)
• Reactome Pathway:
  MHC class II antigen presentation (R-HSA-2132295)
  Interleukin-35 Signalling (R-HSA-8984722)
  Calnexin/calreticulin cycle (R-HSA-901042)
  Interleukin-27 signaling (R-HSA-9020956)
  Maturation of spike protein (R-HSA-9683686)
  Maturation of spike protein (R-HSA-9694548)
  Antigen Presentation (R-HSA-983170)
  Assembly of Viral Components at the Budding Site (R-HSA-168316)

Molecular Interaction Atlas (MIA) of This DOT

43 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Absence epilepsy	DISJPOUD	Strong	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Benign prostatic hyperplasia	DISI3CW2	Strong	Biomarker	[3]
Breast adenocarcinoma	DISMPHJ0	Strong	Altered Expression	[4]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[5]
Central nervous system lymphoma	DISBYQTA	Strong	Biomarker	[6]
Cervical Intraepithelial neoplasia	DISXP757	Strong	Altered Expression	[7]
Charcot marie tooth disease	DIS3BT2L	Strong	Genetic Variation	[8]
Gastric cancer	DISXGOUK	Strong	Biomarker	[2]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[6]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[9]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[2]
Hyperinsulinemia	DISIDWT6	Strong	Biomarker	[10]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[11]
Lyme disease	DISO70G5	Strong	Biomarker	[12]
Measles	DISXSUID	Strong	Biomarker	[13]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[14]
Myocardial infarction	DIS655KI	Strong	Biomarker	[15]
Myocardial ischemia	DISFTVXF	Strong	Biomarker	[16]
Nephrogenic diabetes insipidus	DISKNSJK	Strong	Genetic Variation	[17]
Plasma cell myeloma	DIS0DFZ0	Strong	Altered Expression	[18]
Retinitis pigmentosa	DISCGPY8	Strong	Genetic Variation	[19]
rubella	DISXUI9P	Strong	Biomarker	[20]
Spinal muscular atrophy	DISTLKOB	Strong	Biomarker	[21]
Stomach cancer	DISKIJSX	Strong	Biomarker	[2]
Vitiligo	DISR05SL	Strong	Biomarker	[22]
Von willebrand disease	DIS3TZCH	Strong	Genetic Variation	[23]
Breast cancer	DIS7DPX1	moderate	Altered Expression	[5]
Lung cancer	DISCM4YA	moderate	Biomarker	[24]
Lung carcinoma	DISTR26C	moderate	Biomarker	[24]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[25]
Tuberous sclerosis	DISEMUGZ	moderate	Biomarker	[26]
Arteriosclerosis	DISK5QGC	Limited	Biomarker	[27]
Atherosclerosis	DISMN9J3	Limited	Biomarker	[27]
Bone osteosarcoma	DIST1004	Limited	Altered Expression	[28]
Melanoma	DIS1RRCY	Limited	Biomarker	[29]
Metastatic melanoma	DISSL43L	Limited	Biomarker	[30]
Neoplasm	DISZKGEW	Limited	Biomarker	[31]
Osteosarcoma	DISLQ7E2	Limited	Altered Expression	[28]
Post-traumatic stress disorder	DISHL1EY	Limited	Biomarker	[32]
Prostate cancer	DISF190Y	Limited	Biomarker	[33]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[33]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[34]

27 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Calnexin (CANX).	[35]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Calnexin (CANX).	[36]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Calnexin (CANX).	[37]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Calnexin (CANX).	[38]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Calnexin (CANX).	[39]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Calnexin (CANX).	[40]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Calnexin (CANX).	[41]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Calnexin (CANX).	[42]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Calnexin (CANX).	[43]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Calnexin (CANX).	[44]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Calnexin (CANX).	[45]
Clozapine	DMFC71L	Approved	Clozapine decreases the expression of Calnexin (CANX).	[46]
Acocantherin	DM7JT24	Approved	Acocantherin increases the expression of Calnexin (CANX).	[47]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of Calnexin (CANX).	[48]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of Calnexin (CANX).	[48]
Fenretinide	DMRD5SP	Phase 3	Fenretinide increases the expression of Calnexin (CANX).	[50]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Calnexin (CANX).	[51]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Calnexin (CANX).	[54]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Calnexin (CANX).	[55]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Calnexin (CANX).	[57]
EMODIN	DMAEDQG	Terminated	EMODIN decreases the expression of Calnexin (CANX).	[59]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Calnexin (CANX).	[60]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Calnexin (CANX).	[61]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Calnexin (CANX).	[62]
Okadaic acid	DM47CO1	Investigative	Okadaic acid increases the expression of Calnexin (CANX).	[63]
L-Serine	DM6WPIS	Investigative	L-Serine increases the expression of Calnexin (CANX).	[64]
NMS-873	DMYKZ6U	Investigative	NMS-873 increases the expression of Calnexin (CANX).	[65]

3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Efavirenz	DMC0GSJ	Approved	Efavirenz affects the localization of Calnexin (CANX).	[49]
DNCB	DMDTVYC	Phase 2	DNCB affects the binding of Calnexin (CANX).	[52]
MG-132	DMKA2YS	Preclinical	MG-132 affects the localization of Calnexin (CANX).	[58]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Calnexin (CANX).	[53]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Calnexin (CANX).	[56]

References

• [1] The Cacna1h mutation in the GAERS model of absence epilepsy enhances T-type Ca(2+) currents by altering calnexin-dependent trafficking of Ca(v)3.2 channels.Sci Rep. 2017 Sep 14;7(1):11513. doi: 10.1038/s41598-017-11591-5.
• [2] Cloning and characterization of a novel 90 kDa 'companion' auto-antigen of p62 overexpressed in cancer.Oncogene. 2002 Jul 25;21(32):5006-15. doi: 10.1038/sj.onc.1205625.
• [3] Preferential humoral immune response in prostate cancer to cellular proteins p90 and p62 in a panel of tumor-associated antigens.Prostate. 2005 May 15;63(3):252-8. doi: 10.1002/pros.20181.
• [4] The expression of the molecular chaperone calnexin is decreased in cancer cells grown as colonies compared to monolayer.Biochem Biophys Res Commun. 1997 Sep 8;238(1):66-70. doi: 10.1006/bbrc.1997.7238.
• [5] RSK-mediated down-regulation of PDCD4 is required for proliferation, survival, and migration in a model of triple-negative breast cancer.Oncotarget. 2016 May 10;7(19):27567-83. doi: 10.18632/oncotarget.8375.
• [6] Primary central nervous system lymphoma and atypical glioblastoma: differentiation using the initial area under the curve derived from dynamic contrast-enhanced MR and the apparent diffusion coefficient.Eur Radiol. 2017 Apr;27(4):1344-1351. doi: 10.1007/s00330-016-4484-2. Epub 2016 Jul 19.
• [7] Post-transcriptional and epigenetic regulation of antigen processing machinery (APM) components and HLA-I in cervical cancers from Uighur women.PLoS One. 2012;7(9):e44952. doi: 10.1371/journal.pone.0044952. Epub 2012 Sep 14.
• [8] Rer1 and calnexin regulate endoplasmic reticulum retention of a peripheral myelin protein 22 mutant that causes type 1A Charcot-Marie-Tooth disease.Sci Rep. 2014 Nov 11;4:6992. doi: 10.1038/srep06992.
• [9] p90 ribosomal S6 kinase 2 promotes invasion and metastasis of human head and neck squamous cell carcinoma cells.J Clin Invest. 2010 Apr;120(4):1165-77. doi: 10.1172/JCI40582. Epub 2010 Mar 15.
• [10] Effect of sildenafil citrate treatment in the eNOS knockout mouse model of fetal growth restriction on long-term cardiometabolic outcomes in male offspring.Pharmacol Res. 2018 Nov;137:122-134. doi: 10.1016/j.phrs.2018.09.023. Epub 2018 Oct 5.
• [11] Inhibition of p90 ribosomal S6 kinase attenuates cell migration and proliferation of the human lung adenocarcinoma through phospho-GSK-3 and osteopontin.Mol Cell Biochem. 2016 Jul;418(1-2):21-9. doi: 10.1007/s11010-016-2727-9. Epub 2016 May 28.
• [12] Characterization of the vls antigenic variation loci of the Lyme disease spirochaetes Borrelia garinii Ip90 and Borrelia afzelii ACAI.Mol Microbiol. 2003 Mar;47(5):1407-17. doi: 10.1046/j.1365-2958.2003.03386.x.
• [13] KDELR2 Competes with Measles Virus Envelope Proteins for Cellular Chaperones Reducing Their Chaperone-Mediated Cell Surface Transport.Viruses. 2019 Jan 4;11(1):27. doi: 10.3390/v11010027.
• [14] Calnexin is necessary for T cell transmigration into the central nervous system.JCI Insight. 2018 Mar 8;3(5):e98410. doi: 10.1172/jci.insight.98410.
• [15] Enhanced MiR-711 transcription by PPAR induces endoplasmic reticulum stress-mediated apoptosis targeting calnexin in rat cardiomyocytes after myocardial infarction.J Mol Cell Cardiol. 2018 May;118:36-45. doi: 10.1016/j.yjmcc.2018.03.006. Epub 2018 Mar 6.
• [16] Cardioplegia prevents ischemia-induced transcriptional alterations of cytoprotective genes in rat hearts: a DNA microarray study.J Thorac Cardiovasc Surg. 2005 Oct;130(4):1151. doi: 10.1016/j.jtcvs.2005.06.027.
• [17] Association of calnexin with wild type and mutant AVPR2 that causes nephrogenic diabetes insipidus.Biochemistry. 2001 Jun 12;40(23):6766-75. doi: 10.1021/bi002699r.
• [18] Overcoming immune tolerance against multiple myeloma with lentiviral calnexin-engineered dendritic cells.Mol Ther. 2008 Feb;16(2):269-79. doi: 10.1038/sj.mt.6300369. Epub 2007 Dec 11.
• [19] Calnexin improves the folding efficiency of mutant rhodopsin in the presence of pharmacological chaperone 11-cis-retinal.J Biol Chem. 2009 Nov 27;284(48):33333-42. doi: 10.1074/jbc.M109.043364. Epub 2009 Oct 2.
• [20] Analysis of the function of cytoplasmic fibers formed by the rubella virus nonstructural replicase proteins.Virology. 2010 Oct 25;406(2):212-27. doi: 10.1016/j.virol.2010.07.025. Epub 2010 Aug 8.
• [21] Normalization of Patient-Identified Plasma Biomarkers in SMN7 Mice following Postnatal SMN Restoration.PLoS One. 2016 Dec 1;11(12):e0167077. doi: 10.1371/journal.pone.0167077. eCollection 2016.
• [22] Increased sensitivity of melanocytes to oxidative stress and abnormal expression of tyrosinase-related protein in vitiligo.Br J Dermatol. 2001 Jan;144(1):55-65. doi: 10.1046/j.1365-2133.2001.03952.x.
• [23] Endoplasmic reticulum retention and prolonged association of a von Willebrand's disease-causing von Willebrand factor variant with ERp57 and calnexin.Biochem Biophys Res Commun. 2001 Jan 19;280(2):448-53. doi: 10.1006/bbrc.2000.4139.
• [24] Proteomic analysis of proteins related to prognosis of lung adenocarcinoma.J Proteome Res. 2014 Nov 7;13(11):4686-94. doi: 10.1021/pr4012969. Epub 2014 Jul 8.
• [25] RSK2 signals through stathmin to promote microtubule dynamics and tumor metastasis.Oncogene. 2016 Oct 13;35(41):5412-5421. doi: 10.1038/onc.2016.79. Epub 2016 Apr 4.
• [26] Tumor-promoting phorbol esters and activated Ras inactivate the tuberous sclerosis tumor suppressor complex via p90 ribosomal S6 kinase.Proc Natl Acad Sci U S A. 2004 Sep 14;101(37):13489-94. doi: 10.1073/pnas.0405659101. Epub 2004 Sep 1.
• [27] A crucial role for p90RSK-mediated reduction of ERK5 transcriptional activity in endothelial dysfunction and atherosclerosis.Circulation. 2013 Jan 29;127(4):486-99. doi: 10.1161/CIRCULATIONAHA.112.116988. Epub 2012 Dec 14.
• [28] Circular RNA hsa_circ_0001564 regulates osteosarcoma proliferation and apoptosis by acting miRNA sponge.Biochem Biophys Res Commun. 2018 Jan 15;495(3):2369-2375. doi: 10.1016/j.bbrc.2017.12.050. Epub 2017 Dec 9.
• [29] Fisetin targets YB-1/RSK axis independent of its effect on ERK signaling: insights from in vitro and in vivo melanoma models.Sci Rep. 2018 Oct 24;8(1):15726. doi: 10.1038/s41598-018-33879-w.
• [30] Differential downregulation of endoplasmic reticulum-residing chaperones calnexin and calreticulin in human metastatic melanoma.Cancer Lett. 2004 Jan 20;203(2):225-31. doi: 10.1016/j.canlet.2003.09.036.
• [31] Calnexin Impairs the Antitumor Immunity of CD4(+) and CD8(+) T Cells.Cancer Immunol Res. 2019 Jan;7(1):123-135. doi: 10.1158/2326-6066.CIR-18-0124. Epub 2018 Nov 6.
• [32] Effects of calcium-dependent molecular chaperones and endoplasmic reticulum in the amygdala in rats under singleprolonged stress.Mol Med Rep. 2018 Jan;17(1):1099-1104. doi: 10.3892/mmr.2017.7976. Epub 2017 Nov 6.
• [33] The serine/threonine protein kinase, p90 ribosomal S6 kinase, is an important regulator of prostate cancer cell proliferation.Cancer Res. 2005 Apr 15;65(8):3108-16. doi: 10.1158/0008-5472.CAN-04-3151.
• [34] Endoplasmic reticulum stress activation in adipose tissue induces metabolic syndrome in individuals with familial partial lipodystrophy of the Dunnigan type.Diabetol Metab Syndr. 2018 Feb 9;10:6. doi: 10.1186/s13098-017-0301-6. eCollection 2018.
• [35] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [36] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [37] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [38] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [39] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [40] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [41] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [42] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [43] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [44] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [45] Expression profile analysis of human peripheral blood mononuclear cells in response to aspirin. Arch Immunol Ther Exp (Warsz). 2005 Mar-Apr;53(2):151-8.
• [46] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [47] Proteomics investigation of protein expression changes in ouabain induced apoptosis in human umbilical vein endothelial cells. J Cell Biochem. 2008 Jun 1;104(3):1054-64. doi: 10.1002/jcb.21691.
• [48] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [49] Lon protease: a novel mitochondrial matrix protein in the interconnection between drug-induced mitochondrial dysfunction and endoplasmic reticulum stress. Br J Pharmacol. 2017 Dec;174(23):4409-4429. doi: 10.1111/bph.14045. Epub 2017 Nov 7.
• [50] Targeting homeostatic mechanisms of endoplasmic reticulum stress to increase susceptibility of cancer cells to fenretinide-induced apoptosis: the role of stress proteins ERdj5 and ERp57. Br J Cancer. 2007 Apr 10;96(7):1062-71. doi: 10.1038/sj.bjc.6603672. Epub 2007 Mar 13.
• [51] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [52] Proteomic analysis of the cellular response to a potent sensitiser unveils the dynamics of haptenation in living cells. Toxicology. 2020 Dec 1;445:152603. doi: 10.1016/j.tox.2020.152603. Epub 2020 Sep 28.
• [53] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [54] JQ1 suppresses tumor growth through downregulating LDHA in ovarian cancer. Oncotarget. 2015 Mar 30;6(9):6915-30. doi: 10.18632/oncotarget.3126.
• [55] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [56] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [57] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [58] Absence of Bax switched MG132-induced apoptosis to non-apoptotic cell death that could be suppressed by transcriptional or translational inhibition. Apoptosis. 2007 Dec;12(12):2233-44. doi: 10.1007/s10495-007-0142-0.
• [59] Gene expression alteration during redox-dependent enhancement of arsenic cytotoxicity by emodin in HeLa cells. Cell Res. 2005 Jul;15(7):511-22.
• [60] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [61] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [62] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [63] Whole genome mRNA transcriptomics analysis reveals different modes of action of the diarrheic shellfish poisons okadaic acid and dinophysis toxin-1 versus azaspiracid-1 in Caco-2 cells. Toxicol In Vitro. 2018 Feb;46:102-112.
• [64] Mechanisms of L-Serine Neuroprotection in vitro Include ER Proteostasis Regulation. Neurotox Res. 2018 Jan;33(1):123-132. doi: 10.1007/s12640-017-9829-3. Epub 2017 Nov 2.
• [65] Interleukin-6 induced overexpression of valosin-containing protein (VCP)/p97 is associated with androgen-independent prostate cancer (AIPC) progression. J Cell Physiol. 2018 Oct;233(10):7148-7164. doi: 10.1002/jcp.26639. Epub 2018 Apr 25.