Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYWYL2D)

• DOT Name: Myoglobin (MB)
• Synonyms: Nitrite reductase MB; EC 1.7.-.-; Pseudoperoxidase MB; EC 1.11.1.-
• Gene Name: MB
• Related Disease:
  Acute kidney injury
  Non-insulin dependent diabetes
  Acute coronary syndrome
  Acute myocardial infarction
  Breast neoplasm
  Carcinoma
  Cardiac disease
  Cardiac failure
  Cardiovascular disease
  Clear cell renal carcinoma
  Coagulation defect
  Colon carcinoma
  Congestive heart failure
  Dermatomyositis
  Diabetic kidney disease
  Duchenne muscular dystrophy
  Lung cancer
  Lung carcinoma
  Meningioma
  Mitochondrial disease
  Multiple sclerosis
  Myocardial ischemia
  Myopathy, sarcoplasmic body
  Neoplasm
  Renal cell carcinoma
  Rhabdomyosarcoma
  Type-1/2 diabetes
  Amyotrophic lateral sclerosis
  Coronary atherosclerosis
  Muscular dystrophy
  Neuromuscular disease
  Invasive breast carcinoma
  Adenocarcinoma
  Breast cancer
  Breast carcinoma
  Lung adenocarcinoma
  Melanoma
  Metastatic malignant neoplasm
  Neuroblastoma
  Non-small-cell lung cancer
  Polymyositis
  Prostate cancer
  Prostate carcinoma
• UniProt ID: MYG_HUMAN
• PDB ID: 3RGK
• EC Number: 1.11.1.-; 1.7.-.-
• Pfam ID: PF00042
• Sequence:
  MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE
  DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH
  PGDFGADAQGAMNKALELFRKDMASNYKELGFQG
• Function: Monomeric heme protein which primary function is to store oxygen and facilitate its diffusion within muscle tissues. Reversibly binds oxygen through a pentacoordinated heme iron and enables its timely and efficient release as needed during periods of heightened demand. Depending on the oxidative conditions of tissues and cells, and in addition to its ability to bind oxygen, it also has a nitrite reductase activity whereby it regulates the production of bioactive nitric oxide. Under stress conditions, like hypoxia and anoxia, it also protects cells against reactive oxygen species thanks to its pseudoperoxidase activity.
• Reactome Pathway: Intracellular oxygen transport (R-HSA-8981607)

Molecular Interaction Atlas (MIA) of This DOT

43 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute kidney injury	DISXZG0T	Definitive	Biomarker	[1]
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Biomarker	[2]
Acute coronary syndrome	DIS7DYEW	Strong	Biomarker	[3]
Acute myocardial infarction	DISE3HTG	Strong	Biomarker	[4]
Breast neoplasm	DISNGJLM	Strong	Genetic Variation	[5]
Carcinoma	DISH9F1N	Strong	Altered Expression	[6]
Cardiac disease	DISVO1I5	Strong	Genetic Variation	[7]
Cardiac failure	DISDC067	Strong	Biomarker	[8]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[9]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[10]
Coagulation defect	DIS9X3H6	Strong	Biomarker	[11]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[12]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[8]
Dermatomyositis	DIS50C5O	Strong	Altered Expression	[13]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[14]
Duchenne muscular dystrophy	DISRQ3NV	Strong	Biomarker	[15]
Lung cancer	DISCM4YA	Strong	Altered Expression	[16]
Lung carcinoma	DISTR26C	Strong	Biomarker	[17]
Meningioma	DISPT4TG	Strong	Genetic Variation	[18]
Mitochondrial disease	DISKAHA3	Strong	Altered Expression	[19]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[20]
Myocardial ischemia	DISFTVXF	Strong	Biomarker	[21]
Myopathy, sarcoplasmic body	DIS4AWOQ	Strong	Autosomal dominant	[22]
Neoplasm	DISZKGEW	Strong	Altered Expression	[23]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[10]
Rhabdomyosarcoma	DISNR7MS	Strong	Biomarker	[24]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[14]
Amyotrophic lateral sclerosis	DISF7HVM	moderate	Biomarker	[25]
Coronary atherosclerosis	DISKNDYU	moderate	Biomarker	[21]
Muscular dystrophy	DISJD6P7	moderate	Biomarker	[26]
Neuromuscular disease	DISQTIJZ	moderate	Altered Expression	[25]
Invasive breast carcinoma	DISANYTW	Disputed	Altered Expression	[27]
Adenocarcinoma	DIS3IHTY	Limited	Altered Expression	[28]
Breast cancer	DIS7DPX1	Limited	Altered Expression	[23]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[23]
Lung adenocarcinoma	DISD51WR	Limited	Altered Expression	[28]
Melanoma	DIS1RRCY	Limited	Biomarker	[29]
Metastatic malignant neoplasm	DIS86UK6	Limited	Biomarker	[29]
Neuroblastoma	DISVZBI4	Limited	Altered Expression	[30]
Non-small-cell lung cancer	DIS5Y6R9	Limited	Biomarker	[28]
Polymyositis	DIS5DHFP	Limited	Altered Expression	[13]
Prostate cancer	DISF190Y	Limited	Altered Expression	[5]
Prostate carcinoma	DISMJPLE	Limited	Altered Expression	[5]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Zalcitabine	DMH7MUV	Approved	Myoglobin (MB) increases the Cardiotoxicity ADR of Zalcitabine.	[46]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Myoglobin (MB).	[31]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Myoglobin (MB).	[32]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Myoglobin (MB).	[33]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Myoglobin (MB).	[34]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the activity of Myoglobin (MB).	[35]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Myoglobin (MB).	[36]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Myoglobin (MB).	[38]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Myoglobin (MB).	[39]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Myoglobin (MB).	[40]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Myoglobin (MB).	[42]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Myoglobin (MB).	[43]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Myoglobin (MB).	[44]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of Myoglobin (MB).	[45]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Succinylcholine	DM2ET1M	Approved	Succinylcholine increases the secretion of Myoglobin (MB).	[37]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Myoglobin (MB).	[41]

References

• [1] A causative role for redox cycling of myoglobin and its inhibition by alkalinization in the pathogenesis and treatment of rhabdomyolysis-induced renal failure.J Biol Chem. 1998 Nov 27;273(48):31731-7. doi: 10.1074/jbc.273.48.31731.
• [2] Influence of type 2 diabetes on muscle deoxygenation during ramp incremental cycle exercise.Respir Physiol Neurobiol. 2019 Nov;269:103258. doi: 10.1016/j.resp.2019.103258. Epub 2019 Jul 23.
• [3] Trends in Use of Biomarker Protocols for the Evaluation of Possible Myocardial Infarction.J Am Heart Assoc. 2017 Sep 22;6(9):e005852. doi: 10.1161/JAHA.117.005852.
• [4] A label-free aptasensor FET based on Au nanoparticle decorated Co(3)O(4) nanorods and a SWCNT layer for detection of cardiac troponin T protein.J Mater Chem B. 2020 Jan 7;8(1):18-26. doi: 10.1039/c9tb01989h. Epub 2019 Nov 29.
• [5] The Distinct Gene Regulatory Network of Myoglobin in Prostate and Breast Cancer.PLoS One. 2015 Nov 11;10(11):e0142662. doi: 10.1371/journal.pone.0142662. eCollection 2015.
• [6] Expression and functional regulation of myoglobin in epithelial cancers.Am J Pathol. 2009 Jul;175(1):201-6. doi: 10.2353/ajpath.2009.081124. Epub 2009 Jun 18.
• [7] Analysis of the myoglobin gene in heart disease.Hum Mutat. 1997;9(5):426-30. doi: 10.1002/(SICI)1098-1004(1997)9:5<426::AID-HUMU8>3.0.CO;2-1.
• [8] Porous Hydrogel-Encapsulated Photonic Barcodes for Multiplex Detection of Cardiovascular Biomarkers.ACS Sens. 2019 May 24;4(5):1384-1390. doi: 10.1021/acssensors.9b00352. Epub 2019 Apr 19.
• [9] Sensitive point-of-care monitoring of cardiac biomarker myoglobin using aptamer and ubiquitous personal glucose meter.Biosens Bioelectron. 2015 Feb 15;64:161-4. doi: 10.1016/j.bios.2014.08.079. Epub 2014 Sep 3.
• [10] Myoglobin expression in renal cell carcinoma is regulated by hypoxia.Exp Mol Pathol. 2013 Dec;95(3):307-12. doi: 10.1016/j.yexmp.2013.09.003. Epub 2013 Sep 25.
• [11] Acute renal replacement therapy in patients with major extremity injuries.Minerva Anestesiol. 2018 Jun;84(6):747-755. doi: 10.23736/S0375-9393.18.12474-6. Epub 2018 Feb 5.
• [12] Revisiting the thiosemicarbazonecopper(II) reaction with glutathione. Activity against colorectal carcinoma cell lines.J Inorg Biochem. 2018 Mar;180:69-79. doi: 10.1016/j.jinorgbio.2017.12.005. Epub 2017 Dec 8.
• [13] Serum levels of B-cell activating factor of the TNF family (BAFF) correlate with anti-Jo-1 autoantibodies levels and disease activity in patients with anti-Jo-1positive polymyositis and dermatomyositis.Arthritis Res Ther. 2018 Jul 27;20(1):158. doi: 10.1186/s13075-018-1650-8.
• [14] Growth differentiation factor 15 (GDF-15) is a potential biomarker of both diabetic kidney disease and future cardiovascular events in cohorts of individuals with type 2 diabetes: a proteomics approach.Ups J Med Sci. 2020 Feb;125(1):37-43. doi: 10.1080/03009734.2019.1696430. Epub 2019 Dec 5.
• [15] High urinary ferritin reflects myoglobin iron evacuation in DMD patients.Neuromuscul Disord. 2018 Jul;28(7):564-571. doi: 10.1016/j.nmd.2018.03.008. Epub 2018 Mar 20.
• [16] Significance of Erythropoietin Receptor Antagonist EMP9 in Cancers.Vitam Horm. 2017;105:297-310. doi: 10.1016/bs.vh.2017.03.001. Epub 2017 Apr 18.
• [17] Expression of ERCC1, TYMS, RRM1, TUBB3, non-muscle myosin II, myoglobin and MyoD1 in lung adenocarcinoma pleural effusions predicts survival in patients receiving platinum-based chemotherapy.Mol Med Rep. 2015 May;11(5):3523-32. doi: 10.3892/mmr.2014.3141. Epub 2014 Dec 30.
• [18] Cosmid mapping and locus linkage within the human chromosomal region 22q13.1.Cancer Genet Cytogenet. 1993 Oct 15;70(2):108-11. doi: 10.1016/0165-4608(93)90177-n.
• [19] Overexpressions of myoglobin and antioxidant enzymes in ragged-red fibers of skeletal muscle from patients with mitochondrial encephalomyopathy.Muscle Nerve. 2003 Oct;28(4):484-92. doi: 10.1002/mus.10466.
• [20] MRM-MS of marker peptides and their abundance as a tool for authentication of meat species and meat cuts in single-cut meat products.Food Chem. 2019 Jun 15;283:367-374. doi: 10.1016/j.foodchem.2019.01.007. Epub 2019 Jan 8.
• [21] Technical note: EnVision?FLEX improves the detectability of depletions of myoglobin and troponin T in forensic cases of myocardial ischemia/infarction.Int J Legal Med. 2017 Nov;131(6):1643-1646. doi: 10.1007/s00414-017-1575-9. Epub 2017 Mar 23.
• [22] Myoglobinopathy is an adult-onset autosomal dominant myopathy with characteristic sarcoplasmic inclusions. Nat Commun. 2019 Mar 27;10(1):1396. doi: 10.1038/s41467-019-09111-2.
• [23] Myoglobin induces mitochondrial fusion, thereby inhibiting breast cancer cell proliferation.J Biol Chem. 2019 May 3;294(18):7269-7282. doi: 10.1074/jbc.RA118.006673. Epub 2019 Mar 14.
• [24] Characterization of an embryonal rhabdomyosarcoma cell line showing amplification and over-expression of the N-myc oncogene.Int J Cancer. 1990 Apr 15;45(4):705-11. doi: 10.1002/ijc.2910450423.
• [25] Expression of myoglobin gene in skeletal muscle of patients with neuromuscular diseases.Muscle Nerve. 1994 Jul;17(7):720-4. doi: 10.1002/mus.880170703.
• [26] Variation of serum myoglobin levels in normal individuals. With reference to the use of myoglobin measurements for the detection of women carrying genes for the X-linked muscular dystrophies.J Neurol Sci. 1983 Dec;62(1-3):41-58. doi: 10.1016/0022-510x(83)90188-0.
• [27] Endogenous myoglobin in human breast cancer is a hallmark of luminal cancer phenotype.Br J Cancer. 2010 Jun 8;102(12):1736-45. doi: 10.1038/sj.bjc.6605702.
• [28] Neuroglobin and myoglobin in non-small cell lung cancer: expression, regulation and prognosis.Lung Cancer. 2011 Dec;74(3):411-8. doi: 10.1016/j.lungcan.2011.05.001. Epub 2011 Jun 2.
• [29] Myoglobin does not predict local toxicity in isolated limb perfusion.Int J Hyperthermia. 2017 Sep;33(6):679-683. doi: 10.1080/02656736.2017.1309082. Epub 2017 Apr 10.
• [30] Interactions between amyloid- and hemoglobin: implications for amyloid plaque formation in Alzheimer's disease.PLoS One. 2012;7(3):e33120. doi: 10.1371/journal.pone.0033120. Epub 2012 Mar 6.
• [31] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [32] Functional cardiotoxicity assessment of cosmetic compounds using human-induced pluripotent stem cell-derived cardiomyocytes. Arch Toxicol. 2018 Jan;92(1):371-381.
• [33] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [34] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [35] Preparation and reactions of myoglobin mutants bearing both proximal cysteine ligand and hydrophobic distal cavity: protein models for the active site of P-450. Biochemistry. 1996 Oct 8;35(40):13118-24. doi: 10.1021/bi960459z.
• [36] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [37] Midazolam pretreatment does not ameliorate myoglobinemia or the clinical side effects of succinylcholine. J Clin Anesth. 1993 Sep-Oct;5(5):414-8. doi: 10.1016/0952-8180(93)90107-p.
• [38] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [39] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [40] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [41] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [42] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [43] Transcriptomic?pathway?and?benchmark dose analysis of Bisphenol A, Bisphenol S, Bisphenol F, and 3,3',5,5'-Tetrabromobisphenol A in H9 human embryonic stem cells. Toxicol In Vitro. 2021 Apr;72:105097. doi: 10.1016/j.tiv.2021.105097. Epub 2021 Jan 18.
• [44] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [45] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
• [46] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.