Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZVPEBT)

DOT Name Signal transducer and activator of transcription 5B (STAT5B)
Gene Name STAT5B
Related Disease
Glioma ( )
Growth hormone insensitivity syndrome with immune dysregulation ( )
Melanoma ( )
Acute lymphocytic leukaemia ( )
Adult lymphoma ( )
Advanced cancer ( )
Autoimmune disease ( )
B-cell neoplasm ( )
Breast neoplasm ( )
Childhood acute lymphoblastic leukemia ( )
Colorectal carcinoma ( )
Estrogen-receptor positive breast cancer ( )
Extranodal NK/T-cell Lymphoma ( )
Growth delay due to insulin-like growth factor type 1 deficiency ( )
Growth hormone insensitivity syndrome with immune dysregulation 2, autosomal dominant ( )
Growth hormone insensitivity with immune dysregulation 1, autosomal recessive ( )
Hepatitis C virus infection ( )
Hepatocellular carcinoma ( )
Large granular lymphocytic leukemia ( )
Leukopenia ( )
Lung cancer ( )
Lymphoma ( )
Metastatic malignant neoplasm ( )
Pediatric lymphoma ( )
Polycythemia vera ( )
Primary cutaneous peripheral T-cell lymphoma not otherwise specified ( )
Prostate cancer ( )
Prostate carcinoma ( )
Prostate neoplasm ( )
Rheumatoid arthritis ( )
Severe congenital neutropenia ( )
Small lymphocytic lymphoma ( )
Systemic lupus erythematosus ( )
T lymphoblastic leukaemia ( )
T-cell acute lymphoblastic leukaemia ( )
Type-1 diabetes ( )
Type-1/2 diabetes ( )
Adult glioblastoma ( )
Chronic kidney disease ( )
Non-small-cell lung cancer ( )
T-cell lymphoma ( )
Anemia ( )
leukaemia ( )
Leukemia ( )
Lung carcinoma ( )
Mastocytosis ( )
Myeloproliferative neoplasm ( )
Pulmonary disease ( )
Systemic mastocytosis ( )
UniProt ID
STA5B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
6MBW; 6MBZ
Pfam ID
PF00017 ; PF01017 ; PF02864 ; PF02865 ; PF21354
Sequence
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGG
GSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQ
WIPHAQS
Function
Carries out a dual signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Binds to the GAS element and activates PRL-induced transcription. Positively regulates hematopoietic/erythroid differentiation.
KEGG Pathway
ErbB sig.ling pathway (hsa04012 )
Chemokine sig.ling pathway (hsa04062 )
Necroptosis (hsa04217 )
JAK-STAT sig.ling pathway (hsa04630 )
Th1 and Th2 cell differentiation (hsa04658 )
Th17 cell differentiation (hsa04659 )
Prolactin sig.ling pathway (hsa04917 )
AGE-RAGE sig.ling pathway in diabetic complications (hsa04933 )
Growth hormone synthesis, secretion and action (hsa04935 )
Hepatitis B (hsa05161 )
Measles (hsa05162 )
Human T-cell leukemia virus 1 infection (hsa05166 )
Pathways in cancer (hsa05200 )
Viral carcinogenesis (hsa05203 )
Chemical carcinogenesis - receptor activation (hsa05207 )
Chronic myeloid leukemia (hsa05220 )
Acute myeloid leukemia (hsa05221 )
Non-small cell lung cancer (hsa05223 )
Reactome Pathway
Interleukin-7 signaling (R-HSA-1266695 )
Signaling by SCF-KIT (R-HSA-1433557 )
Signaling by cytosolic FGFR1 fusion mutants (R-HSA-1839117 )
Downstream signal transduction (R-HSA-186763 )
Signaling by Leptin (R-HSA-2586552 )
Interleukin-3, Interleukin-5 and GM-CSF signaling (R-HSA-512988 )
Interleukin-20 family signaling (R-HSA-8854691 )
Interleukin-15 signaling (R-HSA-8983432 )
Interleukin-9 signaling (R-HSA-8985947 )
Interleukin-2 signaling (R-HSA-9020558 )
Interleukin-21 signaling (R-HSA-9020958 )
Erythropoietin activates STAT5 (R-HSA-9027283 )
STAT5 Activation (R-HSA-9645135 )
Signaling by phosphorylated juxtamembrane, extracellular and kinase domain KIT mutants (R-HSA-9670439 )
Signaling by CSF3 (G-CSF) (R-HSA-9674555 )
STAT5 activation downstream of FLT3 ITD mutants (R-HSA-9702518 )
Signaling by FLT3 fusion proteins (R-HSA-9703465 )
Inactivation of CSF3 (G-CSF) signaling (R-HSA-9705462 )
Growth hormone receptor signaling (R-HSA-982772 )
Prolactin receptor signaling (R-HSA-1170546 )

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Glioma DIS5RPEH Definitive Altered Expression [1]
Growth hormone insensitivity syndrome with immune dysregulation DISUJY9X Definitive Semidominant [2]
Melanoma DIS1RRCY Definitive Biomarker [3]
Acute lymphocytic leukaemia DISPX75S Strong Posttranslational Modification [4]
Adult lymphoma DISK8IZR Strong Biomarker [5]
Advanced cancer DISAT1Z9 Strong Biomarker [6]
Autoimmune disease DISORMTM Strong Biomarker [7]
B-cell neoplasm DISVY326 Strong Genetic Variation [8]
Breast neoplasm DISNGJLM Strong Altered Expression [9]
Childhood acute lymphoblastic leukemia DISJ5D6U Strong Posttranslational Modification [4]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [10]
Estrogen-receptor positive breast cancer DIS1H502 Strong Biomarker [11]
Extranodal NK/T-cell Lymphoma DIS72GCL Strong Biomarker [12]
Growth delay due to insulin-like growth factor type 1 deficiency DISHA2HH Strong Genetic Variation [13]
Growth hormone insensitivity syndrome with immune dysregulation 2, autosomal dominant DISNGGMY Strong Autosomal dominant [2]
Growth hormone insensitivity with immune dysregulation 1, autosomal recessive DISJJ233 Strong Autosomal recessive [14]
Hepatitis C virus infection DISQ0M8R Strong Altered Expression [15]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [16]
Large granular lymphocytic leukemia DISHOPPI Strong Biomarker [17]
Leukopenia DISJMBMM Strong Biomarker [18]
Lung cancer DISCM4YA Strong Biomarker [19]
Lymphoma DISN6V4S Strong Biomarker [5]
Metastatic malignant neoplasm DIS86UK6 Strong Altered Expression [20]
Pediatric lymphoma DIS51BK2 Strong Biomarker [5]
Polycythemia vera DISB5FPO Strong Genetic Variation [21]
Primary cutaneous peripheral T-cell lymphoma not otherwise specified DIS5OHQF Strong Genetic Variation [22]
Prostate cancer DISF190Y Strong Biomarker [23]
Prostate carcinoma DISMJPLE Strong Biomarker [23]
Prostate neoplasm DISHDKGQ Strong Altered Expression [24]
Rheumatoid arthritis DISTSB4J Strong Biomarker [25]
Severe congenital neutropenia DISES99N Strong Altered Expression [26]
Small lymphocytic lymphoma DIS30POX Strong Altered Expression [27]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [28]
T lymphoblastic leukaemia DIS2PNPP Strong Altered Expression [29]
T-cell acute lymphoblastic leukaemia DIS17AI2 Strong Biomarker [30]
Type-1 diabetes DIS7HLUB Strong Genetic Variation [31]
Type-1/2 diabetes DISIUHAP Strong Biomarker [32]
Adult glioblastoma DISVP4LU moderate Biomarker [33]
Chronic kidney disease DISW82R7 moderate Biomarker [34]
Non-small-cell lung cancer DIS5Y6R9 moderate Altered Expression [35]
T-cell lymphoma DISSXRTQ moderate Altered Expression [36]
Anemia DISTVL0C Limited Genetic Variation [37]
leukaemia DISS7D1V Limited Biomarker [38]
Leukemia DISNAKFL Limited Biomarker [38]
Lung carcinoma DISTR26C Limited Biomarker [19]
Mastocytosis DIS1TEE0 Limited Biomarker [39]
Myeloproliferative neoplasm DIS5KAPA Limited Biomarker [40]
Pulmonary disease DIS6060I Limited Biomarker [13]
Systemic mastocytosis DISNQ2OY Limited Biomarker [39]
------------------------------------------------------------------------------------
⏷ Show the Full List of 49 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
20 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Signal transducer and activator of transcription 5B (STAT5B). [41]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Signal transducer and activator of transcription 5B (STAT5B). [42]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Signal transducer and activator of transcription 5B (STAT5B). [43]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Signal transducer and activator of transcription 5B (STAT5B). [45]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Signal transducer and activator of transcription 5B (STAT5B). [46]
Progesterone DMUY35B Approved Progesterone increases the expression of Signal transducer and activator of transcription 5B (STAT5B). [47]
Dexamethasone DMMWZET Approved Dexamethasone increases the activity of Signal transducer and activator of transcription 5B (STAT5B). [48]
Aspirin DM672AH Approved Aspirin decreases the expression of Signal transducer and activator of transcription 5B (STAT5B). [49]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of Signal transducer and activator of transcription 5B (STAT5B). [46]
Nicotine DMWX5CO Approved Nicotine increases the expression of Signal transducer and activator of transcription 5B (STAT5B). [50]
Diphenylpyraline DMW4X37 Approved Diphenylpyraline decreases the expression of Signal transducer and activator of transcription 5B (STAT5B). [51]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Signal transducer and activator of transcription 5B (STAT5B). [54]
Tamibarotene DM3G74J Phase 3 Tamibarotene decreases the expression of Signal transducer and activator of transcription 5B (STAT5B). [42]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of Signal transducer and activator of transcription 5B (STAT5B). [56]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of Signal transducer and activator of transcription 5B (STAT5B). [58]
DNCB DMDTVYC Phase 2 DNCB increases the expression of Signal transducer and activator of transcription 5B (STAT5B). [59]
Eugenol DM7US1H Patented Eugenol increases the expression of Signal transducer and activator of transcription 5B (STAT5B). [59]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Signal transducer and activator of transcription 5B (STAT5B). [65]
Butanoic acid DMTAJP7 Investigative Butanoic acid increases the expression of Signal transducer and activator of transcription 5B (STAT5B). [66]
CATECHIN DMY38SB Investigative CATECHIN increases the expression of Signal transducer and activator of transcription 5B (STAT5B). [67]
------------------------------------------------------------------------------------
⏷ Show the Full List of 20 Drug(s)
2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the localization of Signal transducer and activator of transcription 5B (STAT5B). [44]
Resveratrol DM3RWXL Phase 3 Resveratrol affects the localization of Signal transducer and activator of transcription 5B (STAT5B). [55]
------------------------------------------------------------------------------------
11 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tofacitinib DMBS370 Approved Tofacitinib decreases the phosphorylation of Signal transducer and activator of transcription 5B (STAT5B). [52]
AC220 DM8Y4JS Approved AC220 decreases the phosphorylation of Signal transducer and activator of transcription 5B (STAT5B). [53]
Jakafi DMNORK8 Phase 3 Jakafi decreases the phosphorylation of Signal transducer and activator of transcription 5B (STAT5B). [12]
AT9283 DMQ94CT Phase 3 AT9283 decreases the phosphorylation of Signal transducer and activator of transcription 5B (STAT5B). [12]
AZD1480 DMLK59M Phase 2 AZD1480 decreases the phosphorylation of Signal transducer and activator of transcription 5B (STAT5B). [60]
WP-1066 DMUGHWR Phase 1/2 WP-1066 decreases the phosphorylation of Signal transducer and activator of transcription 5B (STAT5B). [61]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Signal transducer and activator of transcription 5B (STAT5B). [62]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the phosphorylation of Signal transducer and activator of transcription 5B (STAT5B). [53]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Signal transducer and activator of transcription 5B (STAT5B). [63]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Signal transducer and activator of transcription 5B (STAT5B). [64]
NORCANTHARIDIN DM9B6Y1 Investigative NORCANTHARIDIN decreases the phosphorylation of Signal transducer and activator of transcription 5B (STAT5B). [68]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)

References

1 EGFRvIII-Stat5 Signaling Enhances Glioblastoma Cell Migration and Survival.Mol Cancer Res. 2018 Jul;16(7):1185-1195. doi: 10.1158/1541-7786.MCR-18-0125. Epub 2018 May 3.
2 Dominant-negative STAT5B mutations cause growth hormone insensitivity with short stature and mild immune dysregulation. Nat Commun. 2018 May 29;9(1):2105. doi: 10.1038/s41467-018-04521-0.
3 STAT3 and STAT5 Targeting for Simultaneous Management of Melanoma and Autoimmune Diseases.Cancers (Basel). 2019 Sep 27;11(10):1448. doi: 10.3390/cancers11101448.
4 Pak1 gene functioned differentially in different BCR-ABL subtypes in leukemiagenesis and treatment response through STAT5 pathway.Leuk Res. 2019 Apr;79:6-16. doi: 10.1016/j.leukres.2019.01.012. Epub 2019 Jan 24.
5 Signal transducer and activator of transcription (STAT)-5: an opportunity for drug development in oncohematology.Oncogene. 2019 Jun;38(24):4657-4668. doi: 10.1038/s41388-019-0752-3. Epub 2019 Feb 19.
6 The potential and controversy of targeting STAT family members in cancer.Semin Cancer Biol. 2020 Feb;60:41-56. doi: 10.1016/j.semcancer.2019.10.002. Epub 2019 Oct 9.
7 Human signal transducer and activator of transcription 5b (STAT5b) mutation causes dysregulated human natural killer cell maturation and impaired lytic function.J Allergy Clin Immunol. 2020 Jan;145(1):345-357.e9. doi: 10.1016/j.jaci.2019.09.016. Epub 2019 Oct 7.
8 Stat5-dependent cardioprotection in late remote ischaemia preconditioning.Cardiovasc Res. 2018 Apr 1;114(5):679-689. doi: 10.1093/cvr/cvy014.
9 Jak2/Stat5 signaling in mammogenesis, breast cancer initiation and progression.J Mammary Gland Biol Neoplasia. 2008 Mar;13(1):93-103. doi: 10.1007/s10911-008-9062-z. Epub 2008 Jan 29.
10 JAK/Stat5-mediated subtype-specific lymphocyte antigen 6 complex, locus G6D (LY6G6D) expression drives mismatch repair proficient colorectal cancer.J Exp Clin Cancer Res. 2019 Jan 22;38(1):28. doi: 10.1186/s13046-018-1019-5.
11 The combination of methylsulfonylmethane and tamoxifen inhibits the Jak2/STAT5b pathway and synergistically inhibits tumor growth and metastasis in ER-positive breast cancer xenografts.BMC Cancer. 2015 Jun 19;15:474. doi: 10.1186/s12885-015-1445-0.
12 STAT5BN642H is a driver mutation for T cell neoplasia. J Clin Invest. 2018 Jan 2;128(1):387-401. doi: 10.1172/JCI94509. Epub 2017 Dec 4.
13 STAT5B deficiency: Impacts on human growth and immunity.Growth Horm IGF Res. 2016 Jun;28:16-20. doi: 10.1016/j.ghir.2015.12.006. Epub 2015 Dec 10.
14 Severe growth hormone insensitivity resulting from total absence of signal transducer and activator of transcription 5b. J Clin Endocrinol Metab. 2005 Jul;90(7):4260-6. doi: 10.1210/jc.2005-0515. Epub 2005 Apr 12.
15 Hepatitis C virus core protein reduces CD8(+) T-cell proliferation, perforin production and degranulation but increases STAT5 activation.Immunology. 2018 May;154(1):156-165. doi: 10.1111/imm.12882. Epub 2018 Jan 25.
16 STAT gene family mRNA expression and prognostic value in hepatocellular carcinoma.Onco Targets Ther. 2019 Sep 3;12:7175-7191. doi: 10.2147/OTT.S202122. eCollection 2019.
17 Mutations in the signal transducer and activator of transcription family of genes in cancer.Cancer Sci. 2018 Apr;109(4):926-933. doi: 10.1111/cas.13525. Epub 2018 Mar 2.
18 Differential STAT5 signaling by ligand-dependent and constitutively active cytokine receptors.J Biol Chem. 2005 Apr 8;280(14):13364-73. doi: 10.1074/jbc.M407326200. Epub 2005 Jan 26.
19 Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model.Cancers (Basel). 2019 Jan 7;11(1):49. doi: 10.3390/cancers11010049.
20 STAT5 expression correlates with recurrence and survival in melanoma patients treated with interferon-.Melanoma Res. 2018 Jun;28(3):204-210. doi: 10.1097/CMR.0000000000000435.
21 Essential role for Stat5a/b in myeloproliferative neoplasms induced by BCR-ABL1 and JAK2(V617F) in mice.Blood. 2012 Apr 12;119(15):3550-60. doi: 10.1182/blood-2011-12-397554. Epub 2012 Jan 10.
22 High activation of STAT5A drives peripheral T-cell lymphoma and leukemia.Haematologica. 2020 Jan 31;105(2):435-447. doi: 10.3324/haematol.2019.216986. Print 2020.
23 Direct Targeting Options for STAT3 and STAT5 in Cancer.Cancers (Basel). 2019 Dec 3;11(12):1930. doi: 10.3390/cancers11121930.
24 STAT5a/b Deficiency Delays, but does not Prevent, Prolactin-Driven Prostate Tumorigenesis in Mice.Cancers (Basel). 2019 Jul 2;11(7):929. doi: 10.3390/cancers11070929.
25 Peficitinib Inhibits the Chemotactic Activity of Monocytes via Proinflammatory Cytokine Production in Rheumatoid Arthritis Fibroblast-Like Synoviocytes.Cells. 2019 Jun 9;8(6):561. doi: 10.3390/cells8060561.
26 A Truncated Granulocyte Colony-stimulating Factor Receptor (G-CSFR) Inhibits Apoptosis Induced by Neutrophil Elastase G185R Mutant: IMPLICATION FOR UNDERSTANDING CSF3R GENE MUTATIONS IN SEVERE CONGENITAL NEUTROPENIA.J Biol Chem. 2017 Feb 24;292(8):3496-3505. doi: 10.1074/jbc.M116.755157. Epub 2017 Jan 10.
27 Mechanism for IL-15-Driven B Cell Chronic Lymphocytic Leukemia Cycling: Roles for AKT and STAT5 in Modulating Cyclin D2 and DNA Damage Response Proteins.J Immunol. 2019 May 15;202(10):2924-2944. doi: 10.4049/jimmunol.1801142. Epub 2019 Apr 15.
28 Altered Homeostasis of Regulatory T Lymphocytes and Differential Regulation of STAT1/STAT5 in CD4+ T Lymphocytes in Childhood-onset Systemic Lupus Erythematosus.J Rheumatol. 2020 Apr;47(4):557-566. doi: 10.3899/jrheum.181418. Epub 2019 Jul 1.
29 JAK/STAT-Activating Genomic Alterations Are a Hallmark of T-PLL.Cancers (Basel). 2019 Nov 21;11(12):1833. doi: 10.3390/cancers11121833.
30 Glucocorticoids paradoxically facilitate steroid resistance in T cell acute lymphoblastic leukemias and thymocytes.J Clin Invest. 2020 Feb 3;130(2):863-876. doi: 10.1172/JCI130189.
31 Transcriptional Regulation of Nos2 via STAT5B Binding to Nos2 Gene Promoter Mediates Nitric Oxide Production: Relevance in -Cell Maintenance.Cell Physiol Biochem. 2019;52(1):141-155. doi: 10.33594/000000010. Epub 2019 Feb 18.
32 Constitutively active Stat5b signaling confers tolerogenic functions to dendritic cells of NOD mice and halts diabetes progression.J Autoimmun. 2017 Jan;76:63-74. doi: 10.1016/j.jaut.2016.09.001. Epub 2016 Sep 12.
33 Correction to: Multiple receptor tyrosine kinases converge on microRNA-134 to control KRAS, STAT5B, and glioblastoma.Cell Death Differ. 2019 Jan;26(1):197. doi: 10.1038/s41418-018-0145-0.
34 You-Gui-Yin improved the reproductive dysfunction of male rats with chronic kidney disease via regulating the HIF1-STAT5 pathway.J Ethnopharmacol. 2020 Jan 10;246:112240. doi: 10.1016/j.jep.2019.112240. Epub 2019 Sep 14.
35 No erythropoietin-induced growth is observed in non-small cell lung cancer cells.Int J Oncol. 2018 Feb;52(2):518-526. doi: 10.3892/ijo.2017.4225. Epub 2017 Dec 12.
36 Tofacitinib induces G1 cell-cycle arrest and inhibits tumor growth in Epstein-Barr virus-associated T and natural killer cell lymphoma cells.Oncotarget. 2016 Nov 22;7(47):76793-76805. doi: 10.18632/oncotarget.12529.
37 Integrative view on how erythropoietin signaling controls transcription patterns in erythroid cells.Curr Opin Hematol. 2018 May;25(3):189-195. doi: 10.1097/MOH.0000000000000415.
38 Twins with different personalities: STAT5B-but not STAT5A-has a key role in BCR/ABL-induced leukemia.Leukemia. 2019 Jul;33(7):1583-1597. doi: 10.1038/s41375-018-0369-5. Epub 2019 Jan 24.
39 CD44 is a RAS/STAT5-regulated invasion receptor that triggers disease expansion in advanced mastocytosis.Blood. 2018 Nov 1;132(18):1936-1950. doi: 10.1182/blood-2018-02-833582. Epub 2018 Jul 17.
40 Loss of pleckstrin-2 reverts lethality and vascular occlusions in JAK2V617F-positive myeloproliferative neoplasms.J Clin Invest. 2018 Jan 2;128(1):125-140. doi: 10.1172/JCI94518. Epub 2017 Nov 20.
41 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
42 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
43 Arsenic trioxide down-regulates antiapoptotic genes and induces cell death in mycosis fungoides tumors in a mouse model. Ann Oncol. 2008 Aug;19(8):1488-1494. doi: 10.1093/annonc/mdn056. Epub 2008 Mar 17.
44 Oxidative stress triggers STAT3 tyrosine phosphorylation and nuclear translocation in human lymphocytes. J Biol Chem. 1999 Jun 18;274(25):17580-6. doi: 10.1074/jbc.274.25.17580.
45 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
46 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
47 Progesterone pre-treatment potentiates EGF pathway signaling in the breast cancer cell line ZR-75. Breast Cancer Res Treat. 2005 Nov;94(2):171-83. doi: 10.1007/s10549-005-7726-6.
48 Differential effect of dexamethasone on cell death and STAT5 activation during in vitro eosinopoiesis. Br J Haematol. 2003 Dec;123(5):933-41. doi: 10.1046/j.1365-2141.2003.04700.x.
49 Expression profile analysis of human peripheral blood mononuclear cells in response to aspirin. Arch Immunol Ther Exp (Warsz). 2005 Mar-Apr;53(2):151-8.
50 Nicotine and 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone induce cyclooxygenase-2 activity in human gastric cancer cells: involvement of nicotinic acetylcholine receptor (nAChR) and beta-adrenergic receptor signaling pathways. Toxicol Appl Pharmacol. 2008 Dec 1;233(2):254-61.
51 Controlled diesel exhaust and allergen coexposure modulates microRNA and gene expression in humans: Effects on inflammatory lung markers. J Allergy Clin Immunol. 2016 Dec;138(6):1690-1700. doi: 10.1016/j.jaci.2016.02.038. Epub 2016 Apr 24.
52 Janus kinase 3-activating mutations identified in natural killer/T-cell lymphoma. Cancer Discov. 2012 Jul;2(7):591-7. doi: 10.1158/2159-8290.CD-12-0028. Epub 2012 Jun 15.
53 BET protein antagonist JQ1 is synergistically lethal with FLT3 tyrosine kinase inhibitor (TKI) and overcomes resistance to FLT3-TKI in AML cells expressing FLT-ITD. Mol Cancer Ther. 2014 Oct;13(10):2315-27. doi: 10.1158/1535-7163.MCT-14-0258. Epub 2014 Jul 22.
54 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
55 Resveratrol attenuates constitutive STAT3 and STAT5 activation through induction of PTP and SHP-2 tyrosine phosphatases and potentiates sorafenib-induced apoptosis in renal cell carcinoma. BMC Nephrol. 2016 Feb 25;17:19. doi: 10.1186/s12882-016-0233-7.
56 Curcumin regulates signal transducer and activator of transcription (STAT) expression in K562 cells. Biochem Pharmacol. 2006 Nov 30;72(11):1547-54. doi: 10.1016/j.bcp.2006.07.029. Epub 2006 Sep 7.
57 STAT5BN642H is a driver mutation for T cell neoplasia. J Clin Invest. 2018 Jan 2;128(1):387-401. doi: 10.1172/JCI94509. Epub 2017 Dec 4.
58 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
59 Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
60 Discovery of 5-chloro-N2-[(1S)-1-(5-fluoropyrimidin-2-yl)ethyl]-N4-(5-methyl-1H-pyrazol-3-yl)pyrimidine-2,4-diamine (AZD1480) as a novel inhibitor of the Jak/Stat pathway. J Med Chem. 2011 Jan 13;54(1):262-76. doi: 10.1021/jm1011319. Epub 2010 Dec 7.
61 WP1066 disrupts Janus kinase-2 and induces caspase-dependent apoptosis in acute myelogenous leukemia cells. Cancer Res. 2007 Dec 1;67(23):11291-9. doi: 10.1158/0008-5472.CAN-07-0593.
62 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
63 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
64 Expression and DNA methylation changes in human breast epithelial cells after bisphenol A exposure. Int J Oncol. 2012 Jul;41(1):369-77.
65 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
66 MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
67 Epicatechin and a cocoa polyphenolic extract modulate gene expression in human Caco-2 cells. J Nutr. 2004 Oct;134(10):2509-16.
68 Norcantharidin induces apoptosis of breast cancer cells: involvement of activities of mitogen activated protein kinases and signal transducers and activators of transcription. Toxicol In Vitro. 2011 Apr;25(3):699-707. doi: 10.1016/j.tiv.2011.01.011. Epub 2011 Jan 23.