Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZVUOOB)

• DOT Name: EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1)
• Synonyms: Extracellular protein S1-5; Fibrillin-like protein; Fibulin-3; FIBL-3
• Gene Name: EFEMP1
• Related Disease:
  Doyne honeycomb retinal dystrophy
  Adenocarcinoma
  Adult glioblastoma
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cervical cancer
  Cervical carcinoma
  Colorectal carcinoma
  Glioma
  Hepatocellular carcinoma
  High blood pressure
  Inherited retinal dystrophy
  Macular degeneration
  Malignant glioma
  Malignant mesothelioma
  Malignant pleural mesothelioma
  Non-small-cell lung cancer
  Osteoarthritis
  Osteosarcoma
  Pancreatic tumour
  Urinary bladder cancer
  Gastric cancer
  Lung carcinoma
  Lung neoplasm
  Neoplasm
  Prostate cancer
  Prostate carcinoma
  Stomach cancer
  Type-1/2 diabetes
  Venous thromboembolism
  Colorectal neoplasm
  Advanced cancer
  Carcinoma
  Carpal tunnel syndrome
  Epithelial ovarian cancer
  Glioblastoma multiforme
  Hereditary macular dystrophy
  Lung cancer
  Pancreatic cancer
  Undifferentiated carcinoma
  Werner syndrome
• UniProt ID: FBLN3_HUMAN
• Pfam ID: PF12662 ; PF07645
• Sequence:
  MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMK
  CVNHYGGYLCLPKTAQIIVNNEQPQQETQPAEGTSGATTGVVAASSMATSGVLPGGGFVA
  SAAAVAGPEMQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAG
  THNCRADQVCINLRGSFACQCPPGYQKRGEQCVDIDECTIPPYCHQRCVNTPGSFYCQCS
  PGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRT
  SSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMCWNYHGGFRCY
  PRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATTIYA
  NTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSS
  VLRLTIIVGPFSF
• Function: Binds EGFR, the EGF receptor, inducing EGFR autophosphorylation and the activation of downstream signaling pathways. May play a role in cell adhesion and migration. May function as a negative regulator of chondrocyte differentiation. In the olfactory epithelium, it may regulate glial cell migration, differentiation and the ability of glial cells to support neuronal neurite outgrowth.
• Tissue Specificity: In the eye, associated with photoreceptor outer and inner segment regions, the nerve fiber layer, outer nuclear layer and inner and outer plexiform layers of the retina.
• Reactome Pathway: Molecules associated with elastic fibres (R-HSA-2129379)

Molecular Interaction Atlas (MIA) of This DOT

43 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Doyne honeycomb retinal dystrophy	DISKFNCT	Definitive	Autosomal dominant	[1]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[2]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[3]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[4]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[5]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[5]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[6]
Cervical cancer	DISFSHPF	Strong	Biomarker	[7]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[7]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[8]
Glioma	DIS5RPEH	Strong	Genetic Variation	[9]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[10]
High blood pressure	DISY2OHH	Strong	Biomarker	[11]
Inherited retinal dystrophy	DISGGL77	Strong	Genetic Variation	[12]
Macular degeneration	DISLKKHD	Strong	Genetic Variation	[13]
Malignant glioma	DISFXKOV	Strong	Biomarker	[14]
Malignant mesothelioma	DISTHJGH	Strong	Biomarker	[15]
Malignant pleural mesothelioma	DIST2R60	Strong	Altered Expression	[16]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[17]
Osteoarthritis	DIS05URM	Strong	Biomarker	[18]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[4]
Pancreatic tumour	DIS3U0LK	Strong	Biomarker	[2]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[19]
Gastric cancer	DISXGOUK	moderate	Biomarker	[20]
Lung carcinoma	DISTR26C	moderate	Biomarker	[21]
Lung neoplasm	DISVARNB	moderate	Altered Expression	[22]
Neoplasm	DISZKGEW	moderate	Altered Expression	[23]
Prostate cancer	DISF190Y	moderate	Biomarker	[24]
Prostate carcinoma	DISMJPLE	moderate	Biomarker	[24]
Stomach cancer	DISKIJSX	moderate	Biomarker	[20]
Type-1/2 diabetes	DISIUHAP	moderate	Altered Expression	[25]
Venous thromboembolism	DISUR7CR	moderate	Genetic Variation	[26]
Colorectal neoplasm	DISR1UCN	Disputed	Biomarker	[27]
Advanced cancer	DISAT1Z9	Limited	Altered Expression	[28]
Carcinoma	DISH9F1N	Limited	Biomarker	[29]
Carpal tunnel syndrome	DISHQ3BE	Limited	Genetic Variation	[30]
Epithelial ovarian cancer	DIS56MH2	Limited	Biomarker	[31]
Glioblastoma multiforme	DISK8246	Limited	Biomarker	[3]
Hereditary macular dystrophy	DISEYSYY	Limited	Genetic Variation	[32]
Lung cancer	DISCM4YA	Limited	Biomarker	[21]
Pancreatic cancer	DISJC981	Limited	Biomarker	[33]
Undifferentiated carcinoma	DISIAZST	Limited	Biomarker	[29]
Werner syndrome	DISZY45W	Limited	Biomarker	[34]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Daunorubicin	DMQUSBT	Approved	EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1) affects the response to substance of Daunorubicin.	[6]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[35]
Decitabine	DMQL8XJ	Approved	Decitabine affects the methylation of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[43]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[54]

24 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[36]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[37]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[38]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[39]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[40]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[41]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[42]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[44]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[45]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[46]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[42]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[47]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[48]
Prednisolone	DMQ8FR2	Approved	Prednisolone increases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[42]
Methylprednisolone	DM4BDON	Approved	Methylprednisolone increases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[42]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol decreases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[50]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[51]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[52]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[53]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[55]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[56]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[57]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[58]
BAY11-7082	DMQNOFA	Investigative	BAY11-7082 decreases the expression of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[2]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Resveratrol	DM3RWXL	Phase 3	Resveratrol affects the secretion of EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1).	[49]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] EFEMP1 expression promotes in vivo tumor growth in human pancreatic adenocarcinoma. Mol Cancer Res. 2009 Feb;7(2):189-98. doi: 10.1158/1541-7786.MCR-08-0132. Epub 2009 Feb 10.
• [3] Development of a Function-Blocking Antibody Against Fibulin-3 as a Targeted Reagent for Glioblastoma.Clin Cancer Res. 2018 Feb 15;24(4):821-833. doi: 10.1158/1078-0432.CCR-17-1628. Epub 2017 Nov 16.
• [4] Fibulin-3 promotes osteosarcoma invasion and metastasis by inducing epithelial to mesenchymal transition and activating the Wnt/-catenin signaling pathway.Sci Rep. 2017 Jul 24;7(1):6215. doi: 10.1038/s41598-017-06353-2.
• [5] Fibulin-3 is a novel TGF- pathway inhibitor in the breast cancer microenvironment.Oncogene. 2015 Nov 5;34(45):5635-47. doi: 10.1038/onc.2015.13. Epub 2015 Mar 30.
• [6] Decreased expression of angiogenesis antagonist EFEMP1 in sporadic breast cancer is caused by aberrant promoter methylation and points to an impact of EFEMP1 as molecular biomarker. Int J Cancer. 2009 Apr 1;124(7):1727-35. doi: 10.1002/ijc.24108.
• [7] Fibulin-3 knockdown inhibits cervical cancer cell growth and metastasis in vitro and in vivo.Sci Rep. 2018 Jul 13;8(1):10594. doi: 10.1038/s41598-018-28906-9.
• [8] FBLN3 inhibited the invasion and metastasis of colorectal cancer through the AKT/mTOR pathway.Neoplasma. 2019 May 23;66(3):336-342. doi: 10.4149/neo_2018_180703N441. Epub 2019 Feb 14.
• [9] Impact of interaction between the G870A and EFEMP1 gene polymorphism on glioma risk in Chinese Han population.Oncotarget. 2017 Jun 6;8(23):37561-37567. doi: 10.18632/oncotarget.16581.
• [10] EFEMP1 inhibits migration of hepatocellular carcinoma by regulating MMP2 and MMP9 via ERK1/2 activity.Oncol Rep. 2016 Jun;35(6):3489-95. doi: 10.3892/or.2016.4733. Epub 2016 Apr 5.
• [11] Mechanism of action of Profilin-1 and Fibulin-3 in vascular remodeling in hypertensive rats.Eur Rev Med Pharmacol Sci. 2019 Sep;23(18):8101-8108. doi: 10.26355/eurrev_201909_19028.
• [12] Malattia Leventinese/Doyne Honeycomb Retinal Dystrophy: Similarities to Age-Related Macular Degeneration and Potential Therapies.Adv Exp Med Biol. 2016;854:153-8. doi: 10.1007/978-3-319-17121-0_21.
• [13] Mutant Fibulin-3 Causes Proteoglycan Accumulation and Impaired Diffusion Across Bruch's Membrane.Invest Ophthalmol Vis Sci. 2017 Jun 1;58(7):3046-3054. doi: 10.1167/iovs.17-21720.
• [14] Tumor-derived fibulin-3 activates pro-invasive NF-B signaling in glioblastoma cells and their microenvironment.Oncogene. 2017 Aug 24;36(34):4875-4886. doi: 10.1038/onc.2017.109. Epub 2017 Apr 17.
• [15] Fibulin-3 as biomarker of malignant mesothelioma.Biomark Med. 2019 Jul;13(10):875-886. doi: 10.2217/bmm-2018-0285. Epub 2019 Jun 25.
• [16] Biomarkers for malignant pleural mesothelioma: a meta-analysis.Carcinogenesis. 2019 Nov 25;40(11):1320-1331. doi: 10.1093/carcin/bgz103.
• [17] Fibulin-3 promoter methylation alters the invasive behavior of non-small cell lung cancer cell lines via MMP-7 and MMP-2 regulation.Int J Oncol. 2012 Feb;40(2):402-8. doi: 10.3892/ijo.2011.1191. Epub 2011 Sep 7.
• [18] Fib3-3 as a Biomarker for Osteoarthritis in a Rat Model with Metabolic Dysregulation.Cartilage. 2019 Jul;10(3):329-334. doi: 10.1177/1947603518754629. Epub 2018 Jan 24.
• [19] Fibulin-3 promotes muscle-invasive bladder cancer.Oncogene. 2017 Sep 14;36(37):5243-5251. doi: 10.1038/onc.2017.149. Epub 2017 May 15.
• [20] Integrated Analysis Identifies Molecular Signatures and Specific Prognostic Factors for Different Gastric Cancer Subtypes.Transl Oncol. 2017 Feb;10(1):99-107. doi: 10.1016/j.tranon.2016.11.003. Epub 2016 Dec 22.
• [21] Role of fibulin-3 in lung cancer: in vivo and in vitro analyses.Oncol Rep. 2014 Jan;31(1):79-86. doi: 10.3892/or.2013.2799. Epub 2013 Oct 18.
• [22] Fibulin-3 suppresses Wnt/-catenin signaling and lung cancer invasion.Carcinogenesis. 2014 Aug;35(8):1707-16. doi: 10.1093/carcin/bgu023. Epub 2014 Jan 30.
• [23] Fibulin-3 Has Anti-Tumorigenic Activities inCutaneous Squamous Cell Carcinoma.J Invest Dermatol. 2019 Aug;139(8):1798-1808.e5. doi: 10.1016/j.jid.2019.01.022. Epub 2019 Feb 6.
• [24] Electrochemical detection of methylated DNA on a microfluidic chip with nanoelectrokinetic pre-concentration.Biosens Bioelectron. 2018 Jun 1;107:103-110. doi: 10.1016/j.bios.2018.01.067. Epub 2018 Feb 1.
• [25] Expressional and functional studies of Wolframin, the gene function deficient in Wolfram syndrome, in mice and patient cells.Exp Gerontol. 2005 Aug-Sep;40(8-9):671-8. doi: 10.1016/j.exger.2005.06.008.
• [26] A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.BMC Med Genet. 2013 Mar 20;14:36. doi: 10.1186/1471-2350-14-36.
• [27] Comparing the DNA hypermethylome with gene mutations in human colorectal cancer.PLoS Genet. 2007 Sep;3(9):1709-23. doi: 10.1371/journal.pgen.0030157. Epub 2007 Jul 31.
• [28] Analysis of fibulin-3 after exposure to asbestos-like fibers.Environ Res. 2017 Jul;156:381-387. doi: 10.1016/j.envres.2017.03.055. Epub 2017 Apr 10.
• [29] cDNA microarray profiling of rat mammary gland carcinomas induced by 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine and 7,12-dimethylbenz[a]anthracene.Carcinogenesis. 2002 Oct;23(10):1561-8. doi: 10.1093/carcin/23.10.1561.
• [30] A genome-wide association analysis identifies 16 novel susceptibility loci for carpal tunnel syndrome.Nat Commun. 2019 Mar 4;10(1):1030. doi: 10.1038/s41467-019-08993-6.
• [31] Overexpression of EFEMP1 correlates with tumor progression and poor prognosis in human ovarian carcinoma.PLoS One. 2013 Nov 13;8(11):e78783. doi: 10.1371/journal.pone.0078783. eCollection 2013.
• [32] Deletion of Efemp1 Is Protective Against the Development of Sub-RPE Deposits in Mouse Eyes.Invest Ophthalmol Vis Sci. 2017 Mar 1;58(3):1455-1461. doi: 10.1167/iovs.16-20955.
• [33] Fibulin-3 negatively regulates ALDH1 via c-MET suppression and increases -radiation-induced sensitivity in some pancreatic cancer cell lines.Biochem Biophys Res Commun. 2014 Nov 21;454(3):369-75. doi: 10.1016/j.bbrc.2014.10.084. Epub 2014 Oct 24.
• [34] Decrease of fibulin-3 in hepatocellular carcinoma indicates poor prognosis.PLoS One. 2013 Aug 1;8(8):e70511. doi: 10.1371/journal.pone.0070511. Print 2013.
• [35] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [36] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [37] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [38] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [39] Integrated assessment by multiple gene expression analysis of quercetin bioactivity on anticancer-related mechanisms in colon cancer cells in vitro. Eur J Nutr. 2005 Mar;44(3):143-56. doi: 10.1007/s00394-004-0503-1. Epub 2004 Apr 30.
• [40] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [41] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [42] Antirheumatic drug response signatures in human chondrocytes: potential molecular targets to stimulate cartilage regeneration. Arthritis Res Ther. 2009;11(1):R15.
• [43] Frequent inactivation of RAMP2, EFEMP1 and Dutt1 in lung cancer by promoter hypermethylation. Clin Cancer Res. 2007 Aug 1;13(15 Pt 1):4336-44. doi: 10.1158/1078-0432.CCR-07-0015.
• [44] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [45] Evaluation of developmental toxicity using undifferentiated human embryonic stem cells. J Appl Toxicol. 2015 Feb;35(2):205-18.
• [46] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [47] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [48] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [49] Calorie restriction-induced changes in the secretome of human adipocytes, comparison with resveratrol-induced secretome effects. Biochim Biophys Acta. 2014 Sep;1844(9):1511-22. doi: 10.1016/j.bbapap.2014.04.023. Epub 2014 May 5.
• [50] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [51] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [52] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [53] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [54] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [55] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [56] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [57] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [58] Persistence of epigenomic effects after recovery from repeated treatment with two nephrocarcinogens. Front Genet. 2018 Dec 3;9:558.
• [59] EFEMP1 expression promotes in vivo tumor growth in human pancreatic adenocarcinoma. Mol Cancer Res. 2009 Feb;7(2):189-98. doi: 10.1158/1541-7786.MCR-08-0132. Epub 2009 Feb 10.
• [60] Decreased expression of angiogenesis antagonist EFEMP1 in sporadic breast cancer is caused by aberrant promoter methylation and points to an impact of EFEMP1 as molecular biomarker. Int J Cancer. 2009 Apr 1;124(7):1727-35. doi: 10.1002/ijc.24108.