Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZVUYG1)

• DOT Name: Metallothionein-1F (MT1F)
• Synonyms: MT-1F; Metallothionein-IF; MT-IF
• Gene Name: MT1F
• Related Disease:
  Amyotrophic lateral sclerosis type 1
  Androgen insensitivity syndrome
  Arteriosclerosis
  Atherosclerosis
  Breast cancer
  Breast carcinoma
  Classic Hodgkin lymphoma
  Colon cancer
  Colon carcinoma
  Colonic neoplasm
  Creutzfeldt Jacob disease
  Glioma
  Graves disease
  Hepatocellular carcinoma
  Huntington disease
  Laryngeal carcinoma
  Laryngeal squamous cell carcinoma
  Lymphosarcoma
  Malignant pleural mesothelioma
  Nephritis
  Systemic lupus erythematosus
  Advanced cancer
  Gastric cancer
  Lung cancer
  Lung carcinoma
  Stomach cancer
  Non-small-cell lung cancer
  Breast neoplasm
  Glaucoma/ocular hypertension
  Invasive ductal breast carcinoma
  Lupus nephritis
  Non-insulin dependent diabetes
  Prostate cancer
  Prostate carcinoma
  Stroke
  Thyroid gland papillary carcinoma
• UniProt ID: MT1F_HUMAN
• Pfam ID: PF00131
• Sequence:
  MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCC
  D
• Function: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
• KEGG Pathway: Mineral absorption (hsa04978)
• Reactome Pathway: Metallothioneins bind metals (R-HSA-5661231)

Molecular Interaction Atlas (MIA) of This DOT

36 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Amyotrophic lateral sclerosis type 1	DIS5A2M0	Strong	Biomarker	[1]
Androgen insensitivity syndrome	DISUZBBO	Strong	Altered Expression	[2]
Arteriosclerosis	DISK5QGC	Strong	Altered Expression	[3]
Atherosclerosis	DISMN9J3	Strong	Altered Expression	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Genetic Variation	[5]
Colon cancer	DISVC52G	Strong	Posttranslational Modification	[6]
Colon carcinoma	DISJYKUO	Strong	Posttranslational Modification	[6]
Colonic neoplasm	DISSZ04P	Strong	Posttranslational Modification	[7]
Creutzfeldt Jacob disease	DISCB6RX	Strong	Biomarker	[8]
Glioma	DIS5RPEH	Strong	Biomarker	[9]
Graves disease	DISU4KOQ	Strong	Biomarker	[10]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[11]
Huntington disease	DISQPLA4	Strong	Altered Expression	[12]
Laryngeal carcinoma	DISNHCIV	Strong	Biomarker	[13]
Laryngeal squamous cell carcinoma	DIS9UUVF	Strong	Biomarker	[13]
Lymphosarcoma	DISGYV3F	Strong	Posttranslational Modification	[14]
Malignant pleural mesothelioma	DIST2R60	Strong	Biomarker	[15]
Nephritis	DISQZQ70	Strong	Altered Expression	[16]
Systemic lupus erythematosus	DISI1SZ7	Strong	Altered Expression	[16]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[17]
Gastric cancer	DISXGOUK	moderate	Altered Expression	[18]
Lung cancer	DISCM4YA	moderate	Genetic Variation	[19]
Lung carcinoma	DISTR26C	moderate	Genetic Variation	[19]
Stomach cancer	DISKIJSX	moderate	Altered Expression	[18]
Non-small-cell lung cancer	DIS5Y6R9	Disputed	Altered Expression	[20]
Breast neoplasm	DISNGJLM	Limited	Altered Expression	[21]
Glaucoma/ocular hypertension	DISLBXBY	Limited	Genetic Variation	[22]
Invasive ductal breast carcinoma	DIS43J58	Limited	Biomarker	[23]
Lupus nephritis	DISCVGPZ	Limited	Altered Expression	[16]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Altered Expression	[24]
Prostate cancer	DISF190Y	Limited	Altered Expression	[25]
Prostate carcinoma	DISMJPLE	Limited	Altered Expression	[25]
Stroke	DISX6UHX	Limited	Biomarker	[26]
Thyroid gland papillary carcinoma	DIS48YMM	Limited	Biomarker	[27]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
DTI-015	DMXZRW0	Approved	Metallothionein-1F (MT1F) affects the response to substance of DTI-015.	[61]

35 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Metallothionein-1F (MT1F).	[28]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Metallothionein-1F (MT1F).	[29]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Metallothionein-1F (MT1F).	[30]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Metallothionein-1F (MT1F).	[31]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Metallothionein-1F (MT1F).	[32]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Metallothionein-1F (MT1F).	[33]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Metallothionein-1F (MT1F).	[34]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Metallothionein-1F (MT1F).	[35]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Metallothionein-1F (MT1F).	[36]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Metallothionein-1F (MT1F).	[37]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Metallothionein-1F (MT1F).	[33]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Metallothionein-1F (MT1F).	[38]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Metallothionein-1F (MT1F).	[39]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Metallothionein-1F (MT1F).	[40]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Metallothionein-1F (MT1F).	[41]
Piroxicam	DMTK234	Approved	Piroxicam increases the expression of Metallothionein-1F (MT1F).	[42]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Metallothionein-1F (MT1F).	[43]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of Metallothionein-1F (MT1F).	[44]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of Metallothionein-1F (MT1F).	[45]
Sodium phenylbutyrate	DMXLBCQ	Approved	Sodium phenylbutyrate increases the expression of Metallothionein-1F (MT1F).	[46]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Metallothionein-1F (MT1F).	[47]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Metallothionein-1F (MT1F).	[37]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Metallothionein-1F (MT1F).	[48]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Metallothionein-1F (MT1F).	[49]
Disulfiram	DMCL2OK	Phase 2 Trial	Disulfiram increases the expression of Metallothionein-1F (MT1F).	[50]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Metallothionein-1F (MT1F).	[51]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Metallothionein-1F (MT1F).	[52]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Metallothionein-1F (MT1F).	[53]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Metallothionein-1F (MT1F).	[54]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Metallothionein-1F (MT1F).	[55]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the expression of Metallothionein-1F (MT1F).	[56]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of Metallothionein-1F (MT1F).	[57]
BRN-3548355	DM4KXT0	Investigative	BRN-3548355 increases the expression of Metallothionein-1F (MT1F).	[58]
Lead acetate	DML0GZ2	Investigative	Lead acetate increases the expression of Metallothionein-1F (MT1F).	[59]
Pyrrolidine dithiocarbamate	DM5ZAS6	Investigative	Pyrrolidine dithiocarbamate increases the expression of Metallothionein-1F (MT1F).	[60]

References

• [1] Reduction of metallothioneins promotes the disease expression of familial amyotrophic lateral sclerosis mice in a dose-dependent manner.Eur J Neurosci. 2001 Apr;13(7):1363-70. doi: 10.1046/j.0953-816x.2001.01512.x.
• [2] Abnormal melatonin receptor 1B expression in osteoblasts from girls with adolescent idiopathic scoliosis.J Pineal Res. 2011 May;50(4):395-402. doi: 10.1111/j.1600-079X.2011.00857.x. Epub 2011 Feb 24.
• [3] The beneficial effects of rosuvastatin are independent of zinc supplementation in patients with atherosclerosis.J Trace Elem Med Biol. 2014 Apr;28(2):194-199. doi: 10.1016/j.jtemb.2014.01.003. Epub 2014 Jan 29.
• [4] A case-control study of Metallothionein-1 expression in breast cancer and breast fibroadenoma.Sci Rep. 2019 May 15;9(1):7407. doi: 10.1038/s41598-019-43565-0.
• [5] A novel MspI PCR-RFLP in the human cytosine 5-methyltransferase gene: lack of relevance for malignant lymphoproliferative disease and breast cancer.Hum Hered. 1998 Jul-Aug;48(4):226-9. doi: 10.1159/000022805.
• [6] Downregulation of metallothionein 1F, a putative oncosuppressor, by loss of heterozygosity in colon cancer tissue.Biochim Biophys Acta. 2012 Jun;1822(6):918-26. doi: 10.1016/j.bbadis.2012.02.021. Epub 2012 Mar 9.
• [7] Induction of apoptosis by wild-type p53 in a human colon tumor-derived cell line.Proc Natl Acad Sci U S A. 1992 May 15;89(10):4495-9. doi: 10.1073/pnas.89.10.4495.
• [8] Differential expression of metallothioneins in human prion diseases.Dement Geriatr Cogn Disord. 2000 Sep-Oct;11(5):251-62. doi: 10.1159/000017247.
• [9] The melatonin-MT1 receptor axis modulates tumor growth in PTEN-mutated gliomas.Biochem Biophys Res Commun. 2018 Feb 19;496(4):1322-1330. doi: 10.1016/j.bbrc.2018.02.010.
• [10] Expression of Metallothionein I/II and Ki-67 Antigen in Graves' Disease.Anticancer Res. 2018 Dec;38(12):6847-6853. doi: 10.21873/anticanres.13059.
• [11] Prognostic Significance of 14-3-3, Aldo-keto Reductase Family 1 B10 and Metallothionein-1 in Hepatocellular Carcinoma.Anticancer Res. 2018 Dec;38(12):6855-6863. doi: 10.21873/anticanres.13060.
• [12] The melatonin MT1 receptor axis modulates mutant Huntingtin-mediated toxicity.J Neurosci. 2011 Oct 12;31(41):14496-507. doi: 10.1523/JNEUROSCI.3059-11.2011.
• [13] Potential biomarkers for head and neck squamous cell carcinoma.Laryngoscope. 2003 Mar;113(3):393-400. doi: 10.1097/00005537-200303000-00001.
• [14] Physical and functional interaction of DNA methyltransferase 3A with Mbd3 and Brg1 in mouse lymphosarcoma cells.Cancer Res. 2005 Dec 1;65(23):10891-900. doi: 10.1158/0008-5472.CAN-05-1455.
• [15] Immunohistochemically detectable metallothionein expression in malignant pleural mesotheliomas is strongly associated with early failure to platin-based chemotherapy.Oncotarget. 2018 Apr 27;9(32):22254-22268. doi: 10.18632/oncotarget.24962. eCollection 2018 Apr 27.
• [16] The renal metallothionein expression profile is altered in human lupus nephritis.Arthritis Res Ther. 2008;10(4):R76. doi: 10.1186/ar2450. Epub 2008 Jul 6.
• [17] Helical organization of microtubules occurs in a minority of tunneling membrane nanotubes in normal and cancer urothelial cells.Sci Rep. 2018 Nov 20;8(1):17133. doi: 10.1038/s41598-018-35370-y.
• [18] Decreased long non-coding RNA MTM contributes to gastric cancer cell migration and invasion via modulating MT1F.Oncotarget. 2017 Oct 26;8(57):97371-97383. doi: 10.18632/oncotarget.22126. eCollection 2017 Nov 14.
• [19] Impact of metallothionein gene polymorphisms on the risk of lung cancer in a Japanese population.Mol Carcinog. 2015 Jun;54 Suppl 1:E122-8. doi: 10.1002/mc.22198. Epub 2014 Aug 30.
• [20] Metallothionein 1F and 2A overexpression predicts poor outcome of non-small cell lung cancer patients.Exp Mol Pathol. 2013 Feb;94(1):301-8. doi: 10.1016/j.yexmp.2012.10.006. Epub 2012 Oct 9.
• [21] Immunohistochemical Expression of Melatonin Receptor MT1 and Glucose Transporter GLUT1 in Human Breast Cancer.Anticancer Agents Med Chem. 2018;18(15):2110-2116. doi: 10.2174/1871520618666181025125532.
• [22] Variations in the myocilin gene in patients with open-angle glaucoma.Arch Ophthalmol. 2002 Sep;120(9):1189-97. doi: 10.1001/archopht.120.9.1189.
• [23] Metallothionein 1F mRNA expression correlates with histological grade in breast carcinoma.Breast Cancer Res Treat. 2001 Apr;66(3):265-72. doi: 10.1023/a:1010658907462.
• [24] Metallothionein-mediated antioxidant defense system and its response to exercise training are impaired in human type 2 diabetes.Diabetes. 2005 Nov;54(11):3089-94. doi: 10.2337/diabetes.54.11.3089.
• [25] Melatonin MT1 receptor-induced transcriptional up-regulation of p27(Kip1) in prostate cancer antiproliferation is mediated via inhibition of constitutively active nuclear factor kappa B (NF-B): potential implications on prostate cancer chemoprevention and therapy.J Pineal Res. 2013 Jan;54(1):69-79. doi: 10.1111/j.1600-079X.2012.01026.x. Epub 2012 Aug 1.
• [26] Metallothionein I as a direct link between therapeutic hematopoietic stem/progenitor cells and cerebral protection in stroke.FASEB J. 2018 May;32(5):2381-2394. doi: 10.1096/fj.201700746R. Epub 2017 Dec 21.
• [27] Metallothionein Isoform Expression in Benign and Malignant Thyroid Lesions.Anticancer Res. 2017 Sep;37(9):5179-5185. doi: 10.21873/anticanres.11940.
• [28] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [29] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [30] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [31] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [32] Expression of copper-responsive genes in HepG2 cells. Mol Cell Biochem. 2005 Nov;279(1-2):141-7.
• [33] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [34] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [35] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [36] Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
• [37] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [38] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [39] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [40] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [41] Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
• [42] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [43] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [44] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [45] Motexafin gadolinium disrupts zinc metabolism in human cancer cell lines. Cancer Res. 2005 May 1;65(9):3837-45.
• [46] Gene expression profile analysis of 4-phenylbutyrate treatment of IB3-1 bronchial epithelial cell line demonstrates a major influence on heat-shock proteins. Physiol Genomics. 2004 Jan 15;16(2):204-11.
• [47] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [48] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [49] Estrogenic GPR30 signalling induces proliferation and migration of breast cancer cells through CTGF. EMBO J. 2009 Mar 4;28(5):523-32.
• [50] High-throughput cell-based screening of 4910 known drugs and drug-like small molecules identifies disulfiram as an inhibitor of prostate cancer cell growth. Clin Cancer Res. 2009 Oct 1;15(19):6070-8.
• [51] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [52] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [53] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [54] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [55] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [56] Identification of palmitate-regulated genes in HepG2 cells by applying microarray analysis. Biochim Biophys Acta. 2007 Sep;1770(9):1283-8. doi: 10.1016/j.bbagen.2007.07.001. Epub 2007 Jul 10.
• [57] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [58] Gene expression profiles in HPV-immortalized human cervical cells treated with the nicotine-derived carcinogen 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone. Chem Biol Interact. 2009 Feb 12;177(3):173-80. doi: 10.1016/j.cbi.2008.10.051. Epub 2008 Nov 6.
• [59] Analysis of lead toxicity in human cells. BMC Genomics. 2012 Jul 27;13:344.
• [60] Effects of a redox-active agent on lymphocyte activation and early gene expression patterns. Free Radic Biol Med. 2004 Nov 15;37(10):1550-63.
• [61] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.