Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTEX248)

DTT Name	Dopamine D2 receptor (D2R)
Synonyms	Dopamine receptor 2; D(2) dopamine receptor
Gene Name	DRD2
DTT Type	Successful target	[1]
BioChemical Class	GPCR rhodopsin
UniProt ID	DRD2_HUMAN
TTD ID	T67162
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA VNPIIYTTFNIEFRKAFLKILHC
Function	Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase.
KEGG Pathway	Rap1 signaling pathway (hsa04015 ) cAMP signaling pathway (hsa04024 ) Neuroactive ligand-receptor interaction (hsa04080 ) Gap junction (hsa04540 ) Dopaminergic synapse (hsa04728 ) Parkinson's disease (hsa05012 ) Cocaine addiction (hsa05030 ) Alcoholism (hsa05034 )
Reactome Pathway	G alpha (i) signalling events (R-HSA-418594 ) Dopamine receptors (R-HSA-390651 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

71 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Acetophenazine	DMZV2PJ	Bipolar disorder	6A60	Approved	[2]
Amisulpride	DMSJVAM	Schizophrenia	6A20	Approved	[3]
Aniracetam	DMOIFW0	Cerebrovascular ischaemia	8B1Z	Approved	[4]
Apomorphine	DMX38HQ	Parkinson disease	8A00.0	Approved	[5]
Aripiprazole	DM3NUMH	Bipolar I disorder		Approved	[6]
Bevantolol	DMZFICR	Hypertension	BA00-BA04	Approved	[7]
Bromocriptine	DMVE3TK	Acromegaly	5A60.0	Approved	[1]
Cabergoline	DMQ4HIN	Hyperprolactinaemia	5A60.1	Approved	[8]
Cariprazine	DMJYDVK	Bipolar disorder	6A60	Approved	[9]
Carphenazine	DMHTB31	Insomnia	7A00-7A0Z	Approved	[2]
Chlorpromazine	DMBGZI3	Acute intermittent hepatic porphyria	5C58.11	Approved	[10]
Chlorprothixene	DMY0KGJ	Psychotic disorder	6A20-6A25	Approved	[11]
Dapiprazole	DMOXJKF	Glaucoma/ocular hypertension	9C61	Approved	[12]
Denopamine	DM8C3GN	Cardiac disease	BA00-BE2Z	Approved	[13]
Dihydroergotamine	DM5IKUF	Cluster headache	8A81.0	Approved	[14]
Dihydroergotoxine	DM5D6WZ	Alzheimer disease	8A20	Approved	[15]
Docarpamine	DMS5IEB	Hypertension	BA00-BA04	Approved	[13]
Domperidone	DMBDPY0	Gastrointestinal disease	DE2Z	Approved	[16]
Dopamine	DMPGUCF	Acromegaly	5A60.0	Approved	[17]
Dopexamine	DMSCIKZ	Cardiac failure	BD10-BD13	Approved	[13]
Droperidol	DM0DXA8	Nausea	MD90	Approved	[18]
Ephedrine	DMMV0KW	Allergic rhinitis	CA08.0	Approved	[19]
Ergonovine	DM0VEC1	Postpartum haemorrhage	JA43	Approved	[20]
Fluspirilene	DMFO843	Schizophrenia	6A20	Approved	[21]
Haloperidol	DM96SE0	Delirium		Approved	[22]
Ibopamine hci	DMGUX67	Cardiac disease	BA00-BE2Z	Approved	[13]
Iloperidone	DM6AUFY	Schizophrenia	6A20	Approved	[23]
Levodopa	DMN3E57	Parkinson disease	8A00.0	Approved	[24]
Levomepromazine	DMIKFEL	Bipolar disorder	6A60	Approved	[25]
Lisuride	DMCME17	Acromegaly	5A60.0	Approved	[26]
Loxapine	DM8AI9U	Bipolar disorder	6A60	Approved	[27]
lumateperone tosylate	DMQ8HOJ	Schizophrenia	6A20	Approved	[28]
Lurasidone hydrochloride	DMCVPXO	Schizophrenia	6A20	Approved	[29]
Meglitinides	DM1OFHN	Type-2 diabetes	5A11	Approved	[30]
Mephentermine	DMFJH5Q	High blood pressure	BA00	Approved	[31]
Mesoridazine	DM2ZGAN	Schizophrenia	6A20	Approved	[32]
Metaraminol	DMWIX23	Hypotension	BA20-BA21	Approved	[33]
Methamphetamine	DMPM4SK	Anxiety		Approved	[34]
Methyldopa	DM5I621	Hypertension	BA00-BA04	Approved	[35]
Metoclopramide	DMFA5MY	Nausea	MD90	Approved	[36]
Molindone	DMAH70G	Schizophrenia	6A20	Approved	[37]
N-0923	DMSOAJ2	Parkinson disease	8A00.0	Approved	[38]
Naphazoline	DMJFZDL	Hyperaemia	9A61-9B7Y	Approved	[39]
Nemonapride	DMY0EKH	Schizophrenia	6A20	Approved	[40]
Olanzapine	DMPFN6Y	Bipolar depression		Approved	[41]
OPC-34712	DMHG57U	Major depressive disorder	6A70.3	Approved	[42]
Perazine	DM2AOTZ	Psychotic disorder	6A20-6A25	Approved	[43]
Pergolide	DM14MAE	Parkinson disease	8A00.0	Approved	[25]
Perphenazine	DMA4MRX	Schizophrenia	6A20	Approved	[44]
Phenoxybenzamine	DM8KSQH	Malignant essential hypertension	BA00	Approved	[45]
Phentolamine	DMXYJOB	Brain ischaemia	8B1Z	Approved	[46]
Phenylephrine	DMZHUO5	Allergic rhinitis	CA08.0	Approved	[47]
Phenyltoloxamine	DMKAEQW	Allergy	4A80-4A85	Approved	[48]
Pimozide	DMW83TP	Schizophrenia	6A20	Approved	[49]
Piperacetazine	DMGQU0Y	Schizophrenia	6A20	Approved	[25]
Pramipexole	DMNMW9R	Parkinson disease	8A00.0	Approved	[25]
Prochlorperazine	DM53SRA	Nausea	MD90	Approved	[50]
Pseudoephedrine	DMIVJ0D	Allergic rhinitis	CA08.0	Approved	[51]
Quetiapine	DM1N62C	Anorexia nervosa cachexia	6B80	Approved	[52]
Quinagolide	DM7WI4Q	Hyperprolactinaemia	5A60.1	Approved	[53]
Risperidone	DMN6DXL	Bipolar I disorder		Approved	[54]
Ropinirole	DMA6S1D	Parkinson disease	8A00.0	Approved	[25]
Sulpiride	DMF54ZG	Schizophrenia	6A20	Approved	[55]
Thiethylperazine	DMU3IET	Nausea	MD90	Approved	[56]
Thioridazine	DM35M8J	Schizophrenia	6A20	Approved	[57]
Thiothixene	DMDINC4	Schizophrenia	6A20	Approved	[58]
Tiapride	DMN6CAG	Alcohol dependence	6C40.2	Approved	[55]
Tolazoline	DMI40NL	Cerebrovascular disease	8B2Z	Approved	[59]
Ziprasidone	DMM58JY	Bipolar disorder	6A60	Approved	[60]
Zuclopenthixol	DMKYD5N	Schizophrenia	6A20	Approved	[61]
Talipexole	DM4TX7J	N. A.	N. A.	Phase 4	[62]
------------------------------------------------------------------------------------


⏷ Show the Full List of 71 Approved Drug(s)

44 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Bis(olanzapine) pamoate monohydrate	DME76AP	Psychotic disorder	6A20-6A25	Phase 3	[63]
Blonanserin	DM36C17	Schizophrenia	6A20	Phase 3	[40]
CQA 206-291	DM60TVK	Parkinson disease	8A00.0	Phase 3	[64]
esamisulpride	DMJ5DAB	Bipolar disorder	6A60	Phase 3	[65]
Lu AF35700	DMNAYUJ	Schizophrenia	6A20	Phase 3	[66]
P2B-001	DM9PVHX	Parkinson disease	8A00.0	Phase 3	[67]
Pridopidine	DMX9YLR	Huntington disease	8A01.10	Phase 3	[68]
RBP-7000	DMPJTZ1	Non-small-cell lung cancer	2C25.Y	Phase 3	[69]
Sumanirole	DMYHV17	Parkinson disease	8A00.0	Phase 3	[38]
Zicronapine	DMP8ESD	Schizophrenia	6A20	Phase 3	[70]
Sarizotan	DMH7IPW	Rett syndrome	LD90.4	Phase 2/3	[71]
APD-403	DM1VITS	Vomiting	MD90	Phase 2	[72]
Aplindore fumarate	DMGJ1X2	Schizophrenia	6A20	Phase 2	[40]
BIM23A760	DM6EIZG	Acromegaly	5A60.0	Phase 2	[73]
BL-1020	DMVDO93	Schizophrenia	6A20	Phase 2	[40]
CGS-15873A	DMKS7RJ	Psychotic disorder	6A20-6A25	Phase 2	[74]
CLR-3001	DM3Z6IQ	Major depressive disorder	6A70.3	Phase 2	[75]
JNJ-37822681	DMV41P5	Schizophrenia	6A20	Phase 2	[76]
Mazapertine succinate	DMJKHVX	Psychotic disorder	6A20-6A25	Phase 2	[71]
Ocaperidone	DMP6B59	Idiopathic pulmonary fibrosis	CB03.4	Phase 2	[77]
ONC201	DMM5SCF	Endometrial cancer	2C76	Phase 2	[78]
Pardoprunox	DMD275X	Parkinson disease	8A00.0	Phase 2	[79]
PD-143188	DMXAH4G	Psychotic disorder	6A20-6A25	Phase 2	[80]
ROXINDOLE	DM15QL9	Psychotic disorder	6A20-6A25	Phase 2	[81]
RP5063	DMKUE8O	Schizophrenia	6A20	Phase 2	[82]
SDZ-MAR-327	DM2YIOE	Psychotic disorder	6A20-6A25	Phase 2	[83]
SEP--4199	DMA12HB	Bipolar disorder	6A60	Phase 2	[84]
TAK-906	DMBQD9H	Diabetic gastroparesis	DA41.00	Phase 2	[85]
TBR-760	DMM5BVG	Pituitary adenoma	2F37.0	Phase 2	[86]
XP-21279	DM8N3ZQ	Parkinson disease	8A00.0	Phase 2	[87]
(-)-3PPP, Maryland	DMG74BY	Schizophrenia	6A20	Phase 1	[40]
1192U90	DM5IPHE	Psychotic disorder	6A20-6A25	Phase 1	[40]
Abaperidone	DMYFB10	Schizophrenia	6A20	Phase 1	[88]
ATI-9242	DM6GKMU	Schizophrenia	6A20	Phase 1	[89]
Carmoxirole	DMU6ZMX	Hypertension	BA00-BA04	Phase 1	[90]
DSP-1200	DM4WSHG	Depression	6A70-6A7Z	Phase 1	[66]
Lu AF28996	DMY572G	Parkinson disease	8A00.0	Phase 1	[91]
Lu-02-750	DMQ0K95	Parkinson disease	8A00.0	Phase 1	[92]
Lu-AE04621	DMP9UO0	Parkinson disease	8A00.0	Phase 1	[93]
ONC206	DM5VY23	Brain and central nervous system tumour	2A00.11	Phase 1	[94]
SKL-10406	DMW64UZ	Major depressive disorder	6A70.3	Phase 1	[95]
SSR-181507	DMXQF1T	Schizophrenia	6A20	Phase 1	[96]
Umespirone	DMTLNGV	Anxiety disorder	6B00-6B0Z	Phase 1	[97]
YKP-1358	DMKHVNE	Schizoaffective disorder	6A21	Phase 1	[98]
------------------------------------------------------------------------------------


⏷ Show the Full List of 44 Clinical Trial Drug(s)

12 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Aryl piperazine derivative 1	DM9DJGU	N. A.	N. A.	Patented	[99]
Aryl piperazine derivative 6	DMZ3DS5	N. A.	N. A.	Patented	[99]
Benzo[d]oxazol-2(3H)-one derivative 1	DMKXD2V	N. A.	N. A.	Patented	[100]
Benzo[d]oxazol-2(3H)-one derivative 2	DM47KWB	N. A.	N. A.	Patented	[100]
Benzo[d]oxazol-2(3H)-one derivative 3	DM3Z5UQ	N. A.	N. A.	Patented	[100]
L-piperazino-3-phenyl-indane derivative 1	DM1STAD	N. A.	N. A.	Patented	[101]
PMID29334795-Compound-62	DMKAFPC	N. A.	N. A.	Patented	[100]
PMID29334795-Compound-66	DMQOF53	N. A.	N. A.	Patented	[100]
PMID29334795-Compound-67	DMC95N7	N. A.	N. A.	Patented	[100]
PMID30124346-Compound-13TABLE4	DMHTJVA	Attention deficit hyperactivity disorder	6A05.Z	Patented	[99]
PMID30124346-Compound-34TABLE4	DM2G3VE	Attention deficit hyperactivity disorder	6A05.Z	Patented	[99]
PMID30124346-Compound-60TABLE5	DM3QX0R	Dyskinesia	MB47.4	Patented	[99]
------------------------------------------------------------------------------------


⏷ Show the Full List of 12 Patented Agent(s)

46 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Fencamfamine	DMVG9YN	Depressive fatigue	MG22	Withdrawn from market	[102]
Flupenthixol	DMY9P37	Schizophrenia	6A20	Withdrawn from market	[103]
Nomifensine	DMCP2TS	Breast cancer	2C60-2C65	Withdrawn from market	[104]
Remoxipride	DMGQF3R	Schizophrenia	6A20	Withdrawn from market	[2]
Sertindole	DMMP65N	Schizophrenia	6A20	Withdrawn from market	[105]
(S)-amisulpride	DMEQ3IW	Schizophrenia	6A20	Discontinued in Phase 4	[40]
Bifeprunox	DMOQIMS	Schizophrenia	6A20	Discontinued in Phase 3	[106]
Lamectacin	DM7RGFW	Bacterial infection	1A00-1C4Z	Discontinued in Phase 3	[107]
NOLOMIROLE HYDROCHLORIDE	DMJL5TR	Heart failure	BD10-BD13	Discontinued in Phase 3	[108]
Sibenadet	DMYQT2V	Chronic obstructive pulmonary disease	CA22	Discontinued in Phase 3	[109]
TIOSPIRONE	DME5QDP	N. A.	N. A.	Discontinued in Phase 3	[110]
BAM-1110	DMPMKUF	Parkinson disease	8A00.0	Discontinued in Phase 2	[111]
Declopramide	DM5QFT4	Inflammatory bowel disease	DD72	Discontinued in Phase 2	[112]
FOSOPAMINE	DMTYHK4	Hypertension	BA00-BA04	Discontinued in Phase 2	[113]
MAZAPERTINE	DMRHYAU	N. A.	N. A.	Discontinued in Phase 2	[114]
Naxagolide	DM9K2IO	Parkinson disease	8A00.0	Discontinued in Phase 2	[115]
PF-217830	DMBDPN2	Bipolar disorder	6A60	Discontinued in Phase 2	[71]
Romergoline	DMYDWHN	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 2	[116]
SAVOXEPIN MESYLATE	DMQMA17	Psychotic disorder	6A20-6A25	Discontinued in Phase 2	[117]
SLV-310	DM71WGZ	Schizophrenia	6A20	Discontinued in Phase 2	[118]
AM-831	DMO7920	Schizophrenia	6A20	Discontinued in Phase 1	[119]
DU-29894	DMN9KXU	Psychotic disorder	6A20-6A25	Discontinued in Phase 1	[120]
Ordopidine	DMQBURK	Psychotic disorder	6A20-6A25	Discontinued in Phase 1	[121]
S-18327	DML6A8X	Psychotic disorder	6A20-6A25	Discontinued in Phase 1	[122]
SDZ-GLC-756	DM1C0K4	Glaucoma/ocular hypertension	9C61	Discontinued in Phase 1	[123]
SLV-313	DMJFWB7	Schizophrenia	6A20	Discontinued in Phase 1	[124]
A-68930	DMUJ94B	Hypertension	BA00-BA04	Terminated	[128]
A-80426	DMBC3DG	N. A.	N. A.	Terminated	[129]
AMR-103	DMW5RNZ	Parkinson disease	8A00.0	Terminated	[130]
BIMG80	DM9X1DZ	Psychotic disorder	6A20-6A25	Terminated	[131]
CGP-25454A	DM5ESZU	Major depressive disorder	6A70.3	Terminated	[132]
CP-903397	DMEJBQY	Schizophrenia	6A20	Terminated	[133]
E-2040	DMZWU8V	Schizophrenia	6A20	Terminated	[134]
Etrabamine	DMRQOXG	Parkinson disease	8A00.0	Terminated	[135]
GMC-283	DMT1RH6	Schizophrenia	6A20	Terminated	[40]
LY-243062	DMIDK36	Inflammation	1A00-CA43.1	Terminated	[136]
NGD-93-1	DMFA26E	Psychotic disorder	6A20-6A25	Terminated	[137]
NNC-22-0031	DMK7BV9	Psychotic disorder	6A20-6A25	Terminated	[138]
Org-10490	DMUGC2X	Psychotic disorder	6A20-6A25	Terminated	[25]
PD-128483	DM0YXRQ	N. A.	N. A.	Terminated	[139]
PNU-96391A	DMLMISK	Substance use disorder	6C4Z	Terminated	[140]
RWJ-25730	DMRQZWN	Psychotic disorder	6A20-6A25	Terminated	[141]
SLV-307	DMCPDBS	Parkinson disease	8A00.0	Terminated	[142]
Y-20024	DM7TQYF	Psychotic disorder	6A20-6A25	Terminated	[143]
Y-931	DMG024B	Schizophrenia	6A20	Terminated	[40]
ZD-3638	DM6M9GC	Schizophrenia	6A20	Terminated	[40]
------------------------------------------------------------------------------------


⏷ Show the Full List of 46 Discontinued Drug(s)

6 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
F-15063	DMUFP05	Schizophrenia	6A20	Preclinical	[125]
Org-23366	DMHQUM2	Schizophrenia	6A20	Preclinical	[40]
PD-157695	DMDSR1X	Schizophrenia	6A20	Preclinical	[40]
PD-158771	DM682UV	Schizophrenia	6A20	Preclinical	[40]
PGX-200097	DM1A2UI	Schizophrenia	6A20	Preclinical	[126]
S32504	DM4V8ZD	Parkinson disease	8A00.0	Preclinical	[127]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Preclinical Drug(s)

216 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(+)-(1R,1'S)-berbamunine hydrochloride	DMF62GN	Discovery agent	N.A.	Investigative	[144]
(+)-(1R,1'S)-thaligrisine hydrochloride	DM521S4	Discovery agent	N.A.	Investigative	[144]
(+)-BUTACLAMOL	DMX6UYN	Discovery agent	N.A.	Investigative	[145]
(+)-S-14297	DMX7ECD	Discovery agent	N.A.	Investigative	[146]
(+/-)-nantenine	DM0L3GE	Discovery agent	N.A.	Investigative	[147]
(-)-(1S,1'R)-O,O-dimethylgrisbine hydrochloride	DM974LP	Discovery agent	N.A.	Investigative	[144]
(-)-3-(1-Propyl-piperidin-3-yl)-benzonitrile	DME5TIR	Discovery agent	N.A.	Investigative	[148]
(4-Ethynyl-cyclohex-3-enyl)-dipropyl-amine	DMHQCRU	Discovery agent	N.A.	Investigative	[149]
(4-Quinolin-2-ylpiperazin-1-yl)acetic Acid	DMKF3U6	Discovery agent	N.A.	Investigative	[150]
(5-Methoxy-chroman-3-yl)-dipropyl-amine	DM4FJHO	Discovery agent	N.A.	Investigative	[151]
(R)-(+)-coclaurine	DM7C148	Discovery agent	N.A.	Investigative	[152]
(R)-(-)-10-methyl-11-hydroxyaporphine	DMYJAM5	Discovery agent	N.A.	Investigative	[153]
(R)-(-)-11-hydroxy-N-n-propylnoraporphine	DMKB621	Discovery agent	N.A.	Investigative	[154]
(R)-(-)-2-methoxy-11-hydroxyaporphine	DMQ2INJ	Discovery agent	N.A.	Investigative	[154]
(R)-(-)-2-methoxy-N-npropylnorapomorphine	DMLXB62	Discovery agent	N.A.	Investigative	[154]
(R)-(-)-2-Methyl-apomorphine hydrochloride	DMAYEJL	Discovery agent	N.A.	Investigative	[155]
(R)-(-)-2-Phenyl-apomorphine hydrochloride	DME62U0	Discovery agent	N.A.	Investigative	[155]
(R)-(-)-N-ethyl-2-methoxy-11-hydroxynoraporphine	DMPSEZV	Discovery agent	N.A.	Investigative	[154]
(R)-(-)-N-propyl-2-methoxy-11-hydroxynoraporphine	DM48SML	Discovery agent	N.A.	Investigative	[154]
(S)-BULBOCAPNINE	DMPI0AX	Discovery agent	N.A.	Investigative	[156]
(S)-secoantioquine hydrochloride	DMG4KIU	Discovery agent	N.A.	Investigative	[144]
(S)APOMORPHINE	DMEKGIX	Discovery agent	N.A.	Investigative	[157]
(S,R)-antioquine hydrochloride	DMIV0MT	Discovery agent	N.A.	Investigative	[144]
(S,R)-isotetrandrine hydrochloride	DMZV52W	Discovery agent	N.A.	Investigative	[144]
(S,R)-pseudoxandrine hydrochloride	DMMRUVF	Discovery agent	N.A.	Investigative	[144]
(S,S)-oxandrine hydrochloride	DMYDS6F	Discovery agent	N.A.	Investigative	[144]
1,2,3,7,12,12a-hexahydro-1-aza-pleiadene-5,6-diol	DMAJ0B4	Discovery agent	N.A.	Investigative	[156]
1,2-Bis-[R-(-)-apomorphine-2'-oxy]ethane	DM9ENXO	Discovery agent	N.A.	Investigative	[158]
1,6-bis(4-(3-chlorophenyl)piperazin-1-yl)hexane	DMDFU6S	Discovery agent	N.A.	Investigative	[159]
1,6-bis(4-(3-methoxyphenyl)piperazin-1-yl)hexane	DMNLUKS	Discovery agent	N.A.	Investigative	[159]
1,6-bis(4-(pyridin-2-yl)piperazin-1-yl)hexane	DM0GRMD	Discovery agent	N.A.	Investigative	[159]
1,6-bis(4-m-tolylpiperazin-1-yl)hexane	DM5Z6XG	Discovery agent	N.A.	Investigative	[159]
1,6-bis(4-phenylpiperazin-1-yl)hexane	DMD3EUI	Discovery agent	N.A.	Investigative	[159]
1-(3-Hydroxyphenyl)-4-propylpiperazine	DMQHFOX	Discovery agent	N.A.	Investigative	[160]
1-(4-(1H-pyrazol-1-yl)benzyl)-4-phenylpiperazine	DMUDVRM	Discovery agent	N.A.	Investigative	[161]
1-(4-(4-phenyl-1-piperazinyl)butyl)indolin-2-one	DMM18AQ	Discovery agent	N.A.	Investigative	[162]
1-(benzyloxy)-2-(2-phenylethyl)benzene	DMVSC3O	Discovery agent	N.A.	Investigative	[163]
1-(benzyloxy)-2-[2-(3-methoxyphenyl)ethyl]benzene	DMVB7P3	Discovery agent	N.A.	Investigative	[163]
1-Aminomethyl-3-cyclohexyl-isochroman-5,6-diol	DMBWNL6	Discovery agent	N.A.	Investigative	[164]
1-Aminomethyl-isochroman-5,6-diol	DM50GS7	Discovery agent	N.A.	Investigative	[128]
1-Benzyl-4-(2-ethynyl-pyrrol-1-yl)-piperidine	DMF0GXD	Discovery agent	N.A.	Investigative	[165]
1-Benzyl-4-(2-iodo-pyrrol-1-yl)-piperidine	DMBRJ5S	Discovery agent	N.A.	Investigative	[165]
1-Benzyl-4-(2-oxazol-5-yl-pyrrol-1-yl)-piperidine	DMSBNY8	Discovery agent	N.A.	Investigative	[165]
1-Benzyl-4-(3-hydroxyphenyl)piperidine	DMCO0JU	Discovery agent	N.A.	Investigative	[160]
1-Benzyl-4-(3-oxazol-5-yl-pyrrol-1-yl)-piperidine	DMCJZVA	Discovery agent	N.A.	Investigative	[165]
1-Benzyl-4-pyrrol-1-yl-piperidine	DMNWEC9	Discovery agent	N.A.	Investigative	[165]
1-Benzyl-4-[3-(methylsulfonyl)phenyl]piperazine	DMOF07G	Discovery agent	N.A.	Investigative	[160]
1-Benzyl-4-[3-(methylsulfonyl)phenyl]piperidine	DME0MDL	Discovery agent	N.A.	Investigative	[160]
1-Dibenzo[b,f]oxepin-10-yl-4-methyl-piperazine	DMOL2Y0	Discovery agent	N.A.	Investigative	[166]
1-Methyl-1,2,3,4-tetrahydro-isoquinoline-6,7-diol	DMI6P91	Discovery agent	N.A.	Investigative	[167]
1-Propyl-3-(3-trifluoromethyl-phenyl)-pyrrolidine	DMOCAUL	Discovery agent	N.A.	Investigative	[168]
1-Propyl-3-m-tolyl-piperidine hydrochloride	DM1387P	Discovery agent	N.A.	Investigative	[169]
1-Propyl-3-o-tolyl-piperidine hydrochloride	DM1O6KQ	Discovery agent	N.A.	Investigative	[169]
1-Propyl-3-p-tolyl-piperidine hydrochloride	DMPMIN9	Discovery agent	N.A.	Investigative	[169]
1-[(3-methoxybenzyl)oxy]-2-(2-phenylethyl)benzene	DM3UHDW	Discovery agent	N.A.	Investigative	[163]
1-[2-(2-Benzyl-phenoxy)-ethyl]-piperidine	DMTNRG7	Discovery agent	N.A.	Investigative	[48]
1-[3-(2-Benzyl-phenoxy)-propyl]-pyrrolidine	DMD2NXL	Discovery agent	N.A.	Investigative	[48]
1-[3-(Methylsulfonyl)phenyl]-4-propylpiperazine	DMS192I	Discovery agent	N.A.	Investigative	[160]
2,3-Dihydro-1H-indol-5-ol	DM3URJG	Discovery agent	N.A.	Investigative	[167]
2-(4-Dipropylamino-cyclohexylidene)-malononitrile	DMXH0FO	Discovery agent	N.A.	Investigative	[149]
2-methoxyapomorphine	DMPG0V7	Discovery agent	N.A.	Investigative	[158]
2-Methyl-8-phenyl-1,2,3,4-tetrahydro-isoquinoline	DMY65CX	Discovery agent	N.A.	Investigative	[170]
2-{[2-(2-phenylethyl)phenoxy]methyl}pyridine	DM1PSRQ	Discovery agent	N.A.	Investigative	[163]
2-{[R-(-)-Apomorphine-2'-oxy]ethoxy}-ethanol	DM9TCWA	Discovery agent	N.A.	Investigative	[158]
3,8-dibromoboldine	DM23CEI	Discovery agent	N.A.	Investigative	[171]
3-(1-Propyl-pyrrolidin-3-yl)-phenol	DM4QRV9	Discovery agent	N.A.	Investigative	[168]
3-(2,3-Dimethyl-phenyl)-1-propyl-piperidine	DM0ZRDV	Discovery agent	N.A.	Investigative	[172]
3-(2,3-Dimethyl-phenyl)-piperidine	DMEFKJD	Discovery agent	N.A.	Investigative	[172]
3-(2,4-Dimethyl-phenyl)-1-propyl-piperidine	DMB71FZ	Discovery agent	N.A.	Investigative	[172]
3-(2,5-Dimethyl-phenyl)-1-propyl-piperidine	DM974E5	Discovery agent	N.A.	Investigative	[172]
3-(2,6-Dimethyl-phenyl)-1-propyl-piperidine	DMPSAQW	Discovery agent	N.A.	Investigative	[172]
3-(2-Benzylamino-ethoxy)-phenol	DMZCTGF	Discovery agent	N.A.	Investigative	[173]
3-(3,4-Dimethyl-phenyl)-1-propyl-piperidine	DM8W9EO	Discovery agent	N.A.	Investigative	[172]
3-(3,4-Dimethyl-phenyl)-piperidine	DMOW0L9	Discovery agent	N.A.	Investigative	[172]
3-(3,5-Dimethyl-phenyl)-1-propyl-piperidine	DMSI3V4	Discovery agent	N.A.	Investigative	[172]
3-(3,5-Dimethyl-phenyl)-piperidine	DMUWKMN	Discovery agent	N.A.	Investigative	[172]
3-(4-Benzyl-piperazin-1-yl)-phenol	DMWPB0G	Discovery agent	N.A.	Investigative	[174]
3-(4-Benzyl-piperidin-1-ylmethyl)-chroman-4-one	DMFVCOP	Discovery agent	N.A.	Investigative	[145]
3-(4-Methyl-piperidin-1-ylmethyl)-1H-indole	DM0HYDZ	Discovery agent	N.A.	Investigative	[175]
3-(4-Phenyl-piperazin-1-ylmethyl)-1H-indole	DM17SNR	Discovery agent	N.A.	Investigative	[175]
3-(4-Phenyl-piperidin-1-ylmethyl)-1H-indole	DMM0WGI	Discovery agent	N.A.	Investigative	[175]
3-(N-propylpiperidin-4-yl)phenol	DM6OCU5	Discovery agent	N.A.	Investigative	[160]
3-(Octahydro-indolizin-8-yl)-phenol	DMJRNI7	Discovery agent	N.A.	Investigative	[176]
3-(Octahydro-quinolizin-1-yl)-phenol	DMU1SGX	Discovery agent	N.A.	Investigative	[176]
3-(Octahydro-quinolizin-3-yl)-phenol	DM01BKR	Discovery agent	N.A.	Investigative	[176]
3-bromoboldine	DMPF7O2	Discovery agent	N.A.	Investigative	[171]
3-Butyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol	DMDOPVM	Discovery agent	N.A.	Investigative	[177]
3-Chloroboldine	DM5J1TX	Discovery agent	N.A.	Investigative	[171]
3-Cyclohexyl-1-propyl-piperidine hydrochloride	DMWMFZ3	Discovery agent	N.A.	Investigative	[169]
3-Ethyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol	DMN8C93	Discovery agent	N.A.	Investigative	[177]
3-Iodoboldine	DM890WJ	Discovery agent	N.A.	Investigative	[171]
3-Naphthalen-1-yl-1-propyl-pyrrolidine	DMNZI9R	Discovery agent	N.A.	Investigative	[168]
3-Naphthalen-1-yl-pyrrolidine	DMCW7F5	Discovery agent	N.A.	Investigative	[168]
3-Phenyl-1-propyl-piperidine hydrochloride	DM568CK	Discovery agent	N.A.	Investigative	[169]
3-Phenyl-1-propyl-pyrrolidine	DMJ0SVB	Discovery agent	N.A.	Investigative	[168]
3-Phenyl-pyrrolidine	DMBTDZL	Discovery agent	N.A.	Investigative	[168]
3-{[2-(2-phenylethyl)phenoxy]methyl}pyridine	DMLZ5F1	Discovery agent	N.A.	Investigative	[163]
4-(2-Benzylamino-ethoxy)-1,3-dihydro-indol-2-one	DMYVD2E	Discovery agent	N.A.	Investigative	[173]
4-(4-Benzyl-piperazin-1-yl)-1H-benzoimidazole	DMXAEW9	Discovery agent	N.A.	Investigative	[174]
4-(4-Benzyl-piperazin-1-yl)-1H-indole	DMWR0AS	Discovery agent	N.A.	Investigative	[174]
4-(4-Benzyl-piperazin-1-yl)-5-chloro-1H-indole	DMZ4237	Discovery agent	N.A.	Investigative	[174]
4-(4-Benzyl-piperazin-1-yl)-7-bromo-1H-indole	DMVAB7U	Discovery agent	N.A.	Investigative	[174]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one	DMM9X0G	Discovery agent	N.A.	Investigative	[178]
4-Benzyl-1-chroman-2-ylmethyl-piperidine	DM6XLZ0	Discovery agent	N.A.	Investigative	[145]
4-Benzyl-1-chroman-3-ylmethyl-piperidine	DMAZMPF	Discovery agent	N.A.	Investigative	[145]
4-Benzyl-1-indan-2-ylmethyl-piperidine	DMES9AJ	Discovery agent	N.A.	Investigative	[145]
5-OH-DPAT	DMZT6JR	Discovery agent	N.A.	Investigative	[179]
7-(2-Amino-ethyl)-4-hydroxy-3H-benzothiazol-2-one	DMPV674	Discovery agent	N.A.	Investigative	[180]
7-(2-Dipropylamino-ethyl)-3H-benzothiazol-2-one	DMWXGLE	Discovery agent	N.A.	Investigative	[180]
7-trans-OH-PIPAT	DMOQMA0	Discovery agent	N.A.	Investigative	[181]
A-690344	DMT6A7G	Schizophrenia	6A20	Investigative	[182]
A-706149	DMXOPFU	Discovery agent	N.A.	Investigative	[183]
ANOLOBINE	DM6DYZ0	Discovery agent	N.A.	Investigative	[156]
ANONAINE	DMM5PEV	Discovery agent	N.A.	Investigative	[156]
Anti-D	DMG7PC0	Idiopathic thrombocytopenic purpura	3B64.10	Investigative	[184]
Azaperone	DMKI2GJ	Discovery agent	N.A.	Investigative	[185]
Benzyl-[2-(1H-indazol-4-yloxy)-ethyl]-amine	DMTC4G0	Discovery agent	N.A.	Investigative	[173]
Benzyl-[2-(1H-indol-4-yloxy)-ethyl]-amine	DMV6DY7	Discovery agent	N.A.	Investigative	[173]
Bis-{[R-(-)-apomorphine-2-oxy]ethyl} ether	DMYSQ2B	Discovery agent	N.A.	Investigative	[158]
BOLDINE	DMMVB5P	Discovery agent	N.A.	Investigative	[171]
BRL-25594	DMD0YL1	Discovery agent	N.A.	Investigative	[186]
BRL-26175	DMQ4MFY	Discovery agent	N.A.	Investigative	[187]
CLEBOPRIDE	DMTLOU6	Discovery agent	N.A.	Investigative	[186]
CLR-151	DM9LSOW	Psychotic disorder	6A20-6A25	Investigative	[72]
D-189	DMU8BJH	Discovery agent	N.A.	Investigative	[188]
D-190	DMUMNSW	Discovery agent	N.A.	Investigative	[188]
D-192	DM8D26T	Discovery agent	N.A.	Investigative	[188]
D-193	DMU83T7	Discovery agent	N.A.	Investigative	[188]
D-203	DMKPIH0	Discovery agent	N.A.	Investigative	[188]
D-210	DMNLE4S	Discovery agent	N.A.	Investigative	[188]
D-218	DMQLT84	Discovery agent	N.A.	Investigative	[188]
D-219	DMQ2U4G	Discovery agent	N.A.	Investigative	[188]
D-220	DMTUJWN	Discovery agent	N.A.	Investigative	[188]
D-237	DMGA48T	Discovery agent	N.A.	Investigative	[189]
D-264	DMWLHBQ	Discovery agent	N.A.	Investigative	[190]
D-315	DMG1CD5	Discovery agent	N.A.	Investigative	[191]
D-366	DMZAM3G	Discovery agent	N.A.	Investigative	[179]
EPIDEPRIDE	DMGKIYE	Discovery agent	N.A.	Investigative	[192]
Ethyl-(4,5,6,7-tetrahydro-2H-indazol-5-yl)-amine	DMYFK4L	Discovery agent	N.A.	Investigative	[193]
ETICLOPRIDE	DM4FW3H	Discovery agent	N.A.	Investigative	[194]
Etoloxamine	DMDOX1Z	Discovery agent	N.A.	Investigative	[48]
FLUANISONE	DMQSDM7	Discovery agent	N.A.	Investigative	[195]
FLUMEZAPINE	DMW0HOG	Discovery agent	N.A.	Investigative	[196]
FLUTROLINE	DMUOHVL	Discovery agent	N.A.	Investigative	[197]
GLAUCINE	DMSP7V8	Discovery agent	N.A.	Investigative	[156]
IBZM	DMUSRJ8	Discovery agent	N.A.	Investigative	[192]
IODOPRIDE	DM0749Z	Discovery agent	N.A.	Investigative	[192]
IODOSULPIRIDE	DMXYFMB	Discovery agent	N.A.	Investigative	[192]
ISOCLOZAPINE	DM52CPU	Discovery agent	N.A.	Investigative	[198]
ISOLOXAPINE	DMH1BN4	Discovery agent	N.A.	Investigative	[199]
L-741626	DMCYQJF	Discovery agent	N.A.	Investigative	[200]
LP-12	DM8ZR17	Discovery agent	N.A.	Investigative	[201]
LP-211	DMKDGLA	Discovery agent	N.A.	Investigative	[202]
LP-44	DM0C3SF	Discovery agent	N.A.	Investigative	[201]
MCL-515	DMTB8D4	Discovery agent	N.A.	Investigative	[203]
MCL-516	DMQA7ZI	Discovery agent	N.A.	Investigative	[203]
ML321	DMVELYW	Discovery agent	N.A.	Investigative	[204]
MLS1547	DMPTBJZ	Discovery agent	N.A.	Investigative	[205]
N-(4-Dipropylaminobutyl)-4-biphenylcarboxamide	DMU1ATH	Discovery agent	N.A.	Investigative	[206]
N-Benzyl-4-(2-diphenyl)-1-piperazinehexanamide	DMCJWQT	Discovery agent	N.A.	Investigative	[202]
N-Ethyl-2-methylnorapomorphine hydrochloride	DMWLI4U	Discovery agent	N.A.	Investigative	[207]
N-Ethyl-2-phenylnorapomorphine hydrochloride	DM6HMBW	Discovery agent	N.A.	Investigative	[207]
N-Propyl-2-methylnorapomorphine hydrochloride	DMKBG1F	Discovery agent	N.A.	Investigative	[207]
N-Propyl-2-phenylnorapomorphine hydrochloride	DML6SAG	Discovery agent	N.A.	Investigative	[207]
N-propylnorapomorphine	DMO7MTX	N. A.	N. A.	Investigative	[208]
nafadotride	DM79KLR	Discovery agent	N.A.	Investigative	[209]
NOR-ROEFRACTINE	DMSZWGN	Discovery agent	N.A.	Investigative	[152]
OCTOCLOTHEPIN	DM0UADK	Discovery agent	N.A.	Investigative	[210]
PD 128907	DMYC51H	Discovery agent	N.A.	Investigative	[211]
PD-135111	DMYEFAV	Discovery agent	N.A.	Investigative	[139]
PD-135146	DMZ4LDC	Discovery agent	N.A.	Investigative	[139]
PD-135188	DMSHBLF	Discovery agent	N.A.	Investigative	[139]
PD-135222	DM0LTNJ	Discovery agent	N.A.	Investigative	[139]
PD-135385	DMX294V	Discovery agent	N.A.	Investigative	[139]
PD-135478	DM56PBI	Discovery agent	N.A.	Investigative	[139]
PD-135540	DMI4MPZ	Discovery agent	N.A.	Investigative	[139]
PD-137789	DM9ZK6L	Discovery agent	N.A.	Investigative	[139]
PD-137821	DMYMFSE	Discovery agent	N.A.	Investigative	[139]
PD-168077	DMX1AY4	Discovery agent	N.A.	Investigative	[169]
PD-172938	DM29GUY	Discovery agent	N.A.	Investigative	[212]
PD-172939	DMI8JTE	Discovery agent	N.A.	Investigative	[212]
PF-03800130	DM5NBVG	Bipolar disorder	6A60	Investigative	[72]
PG-01037	DM2TP4Q	Discovery agent	N.A.	Investigative	[213]
piribedil	DMNP6QD	Discovery agent	N.A.	Investigative	[214]
Preclamol	DMHEV75	Discovery agent	N.A.	Investigative	[176]
Propyl-(4,5,6,7-tetrahydro-2H-indazol-5-yl)-amine	DMZ40RQ	Discovery agent	N.A.	Investigative	[193]
PUKATEINE	DM4SGVF	Discovery agent	N.A.	Investigative	[156]
QUINPIROLE	DMDNHEP	Discovery agent	N.A.	Investigative	[172]
Ro-21-7767	DMOE0JX	Discovery agent	N.A.	Investigative	[215]
Rolicyclidine	DM5HV4W	Discovery agent	N.A.	Investigative	[216]
Rotigitine	DMT0DW4	Parkinson disease	8A00.0	Investigative	[217]
S-(-)-sulpiride	DM1D7KY	Discovery agent	N.A.	Investigative	[55]
SB-258719	DMO01AG	Discovery agent	N.A.	Investigative	[218]
SB-271046	DM5VJAF	Discovery agent	N.A.	Investigative	[219]
SB269652	DMEGNJK	Discovery agent	N.A.	Investigative	[220]
SCH-24518	DM6SC5K	Discovery agent	N.A.	Investigative	[221]
SDZ-208911	DMLPRU4	Psychotic disorder	6A20-6A25	Investigative	[222]
SEL-73	DMFKE6C	Psychiatric disorder	6E8Z	Investigative	[72]
SK&F-89626	DM3SUKX	Discovery agent	N.A.	Investigative	[223]
SKF-89124A	DMNUQ9P	Discovery agent	N.A.	Investigative	[180]
SLV-314	DMPETL7	Discovery agent	N.A.	Investigative	[224]
SNAP-94847	DMMHQDX	Discovery agent	N.A.	Investigative	[225]
STEPHOLIDINE	DMGMXQC	Discovery agent	N.A.	Investigative	[226]
UH-232	DM5K6ZE	Discovery agent	N.A.	Investigative	[227]
UH-301	DM5NYWV	N. A.	N. A.	Investigative	[228]
Uinagolide	DMOVY6L	Discovery agent	N.A.	Investigative	[53]
UNC0006	DMXSTF2	Discovery agent	N.A.	Investigative	[229]
UNC9975	DM4RDVO	Discovery agent	N.A.	Investigative	[229]
UNC9994	DMDK86V	Discovery agent	N.A.	Investigative	[229]
WAY-208466	DM9K2LU	Discovery agent	N.A.	Investigative	[230]
WS-50030	DM6A08D	Schizophrenia	6A20	Investigative	[72]
[2-(1H-Benzoimidazol-4-yloxy)-ethyl]-benzyl-amine	DMSPMHE	Discovery agent	N.A.	Investigative	[173]
[3H]7-OH-DPAT	DM2PW8T	Discovery agent	N.A.	Investigative	[189]
[3H]N-methylspiperone	DM5176Y	Discovery agent	N.A.	Investigative	[231]
[3H]spiperone	DMWHEV8	Discovery agent	N.A.	Investigative	[232]
[R-(-)-Apomorphine-2-yl]-(2'-hydroxy-ethyl)ether	DM8YF3V	Discovery agent	N.A.	Investigative	[158]
------------------------------------------------------------------------------------


⏷ Show the Full List of 216 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Lung cancer	2C82	Lung tissue	2.88E-02	-0.05	-0.2
Alzheimer's disease	8A00.0	Entorhinal cortex	2.50E-02	-0.08	-0.49
Chronic obstructive pulmonary disease	CA23	Lung tissue	3.65E-02	0.11	0.57
Chronic obstructive pulmonary disease	CA23	Small airway epithelium	9.83E-01	6.16E-03	0.03
Schizophrenia	6A20	Pre-frontal cortex	9.39E-01	-0.01	-0.05
Schizophrenia	6A20	Superior temporal cortex	9.91E-01	-0.02	-0.28
Bipolar disorder	6A20	Pre-frontal cortex	9.12E-02	-0.07	-0.52
Parkinson's disease	8A00.0	Substantia nigra tissue	2.20E-03	-0.51	-1.35
Breast cancer	2C82	Breast tissue	8.65E-08	-0.1	-0.47
Major depressive disorder	6A20	Pre-frontal cortex	8.40E-01	4.29E-03	0.03
------------------------------------------------------------------------------------


⏷ Show the Full List of DTT Expression Under 10 Diseases

References

1	Silymarin BIO-C, an extract from Silybum marianum fruits, induces hyperprolactinemia in intact female rats. Phytomedicine. 2009 Sep;16(9):839-44.
2	Atypical antipsychotics: mechanism of action. Can J Psychiatry. 2002 Feb;47(1):27-38.
3	Mechanism of action of atypical antipsychotic drugs and the neurobiology of schizophrenia. CNS Drugs. 2006;20(5):389-409.
4	Anxiolytic effects of aniracetam in three different mouse models of anxiety and the underlying mechanism. Eur J Pharmacol. 2001 May 18;420(1):33-43.
5	Dopamine D(2/3) receptor occupancy of apomorphine in the nonhuman primate brain--a comparative PET study with [11C]raclopride and [11C]MNPA. Synapse. 2009 May;63(5):378-89.
6	Aripiprazole acts as a selective dopamine D2 receptor partial agonist. Expert Opin Investig Drugs. 2007 Jun;16(6):771-5.
7	Determination of bevantolol in human plasma by high performance liquid chromatography using solid phase extraction technique. Arch Pharm Res. 2007 Jul;30(7):890-7.
8	Role of D1 and D2 receptors in the regulation of voluntary movements. Bull Exp Biol Med. 2008 Jul;146(1):14-7.
9	Radium 223 dichloride for prostate cancer treatment. Drug Des Devel Ther. 2017 Sep 6;11:2643-2651.
10	Modulatory role of dopamine D2 receptors and fundamental role of L-type Ca2+ channels in the induction of long-term potentiation in the basolateral... Eur J Pharmacol. 2009 Mar 15;606(1-3):90-3.
11	Potential utility of histamine H3 receptor antagonist pharmacophore in antipsychotics. Bioorg Med Chem Lett. 2009 Jan 15;19(2):538-42.
12	Effect of ibopamine on aqueous humor production in normotensive humans. Invest Ophthalmol Vis Sci. 2003 Nov;44(11):4853-8.
13	Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77.
14	Current and prospective pharmacological targets in relation to antimigraine action. Naunyn Schmiedebergs Arch Pharmacol. 2008 Oct;378(4):371-94.
15	Pharmacologic management of Alzheimer disease, Part II: Antioxidants, antihypertensives, and ergoloid derivatives. Ann Pharmacother. 1999 Feb;33(2):188-97.
16	Screening of domperidone in wastewater by high performance liquid chromatography and solid phase extraction methods. Talanta. 2006 Jan 15;68(3):928-31.
17	The Detection of Dopamine Gene Receptors (DRD1-DRD5) Expression on Human Peripheral Blood Lymphocytes by Real Time PCR. Iran J Allergy Asthma Immunol. 2004 Dec;3(4):169-74.
18	Alpha-adrenergic blockade: a possible mechanism of tocolytic action of certain benzodiazepines in a postpartum rat model in vivo. Life Sci. 2003 Jan 24;72(10):1093-102.
19	The effect of alpha-2 adrenergic agonists on memory and cognitive flexibility. Cogn Behav Neurol. 2006 Dec;19(4):204-7.
20	Agonist profile of ergometrine (ergonovine) on a population of postsynaptic alpha-adrenoceptors. J Pharm Pharmacol. 1988 Feb;40(2):137-9.
21	Inhibition of glutamate release by fluspirilene in cerebrocortical nerve terminals (synaptosomes). Synapse. 2002 Apr;44(1):36-41.
22	Dopaminergic synapses in the matrix of the ventrolateral striatum after chronic haloperidol treatment. Synapse. 2002 Aug;45(2):78-85.
23	Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
24	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3639).
25	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
26	Fibrotic heart-valve reactions to dopamine-agonist treatment in Parkinson's disease. Lancet Neurol. 2007 Sep;6(9):826-9.
27	Remoxipride in Parkinson's disease: differential response in patients with dyskinesias fluctuations versus psychosis. Clin Neuropharmacol. 1995 Feb;18(1):39-45.
28	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019
29	Mullard A: 2010 FDA drug approvals. Nat Rev Drug Discov. 2011 Feb;10(2):82-5.
30	Specific in vitro and in vivo binding of 3H-raclopride. A potent substituted benzamide drug with high affinity for dopamine D-2 receptors in the rat brain. Biochem Pharmacol. 1985 Jul 1;34(13):2251-9.
31	Present state of alpha- and beta-adrenergic drugs I. The adrenergic receptor. Am Heart J. 1976 Nov;92(5):661-4.
32	Intrinsic efficacy of antipsychotics at human D2, D3, and D4 dopamine receptors: identification of the clozapine metabolite N-desmethylclozapine as... J Pharmacol Exp Ther. 2005 Dec;315(3):1278-87.
33	Alpha1-adrenoceptor stimulation enhances experimental gastric carcinogenesis induced by N-methyl-N'-nitro-N-nitrosoguanidine in Wistar rats. Int J Cancer. 1998 Jul 29;77(3):467-9.
34	Pharmacotherapy for obesity. Drugs. 2005;65(10):1391-418.
35	Centrally acting antihypertensive agents: an update. J Clin Hypertens (Greenwich). 2007 May;9(5):399-405.
36	Mechanisms for metoclopramide-mediated sensitization and haloperidol-induced catalepsy in rats. Eur J Pharmacol. 2008 Jun 10;587(1-3):181-6.
37	Molindone for schizophrenia and severe mental illness. Cochrane Database Syst Rev. 2007 Jan 24;(1):CD002083.
38	Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42.
39	Decongestants in treatment of nasal obstruction. Otolaryngol Pol. 1999;53(3):347-52.
40	The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22.
41	Olanzapine: an updated review of its use in the management of schizophrenia. Drugs. 2001;61(1):111-61.
42	Effects of brexpiprazole, a novel serotonin-dopamine activity modulator, on phencyclidine-induced cognitive deficits in mice: a role for serotonin 5-HT1A receptors.Pharmacol Biochem Behav.2014 Sep;124:245-9.
43	Synthesis and in vitro binding of N-phenyl piperazine analogs as potential dopamine D3 receptor ligands. Bioorg Med Chem. 2005 Jan 3;13(1):77-87.
44	CYP2D6 and DRD2 genes differentially impact pharmacodynamic sensitivity and time course of prolactin response to perphenazine. Pharmacogenet Genomics. 2007 Nov;17(11):989-93.
45	Catecholamine-secreting neuroblastoma in a 4-month-old infant: perioperative management. J Clin Anesth. 2009 Feb;21(1):54-6.
46	Nesfatin-1 exerts cardiovascular actions in brain: possible interaction with the central melanocortin system. Am J Physiol Regul Integr Comp Physiol. 2009 Aug;297(2):R330-6.
47	MMP-2 induced vein relaxation via inhibition of [Ca2+]e-dependent mechanisms of venous smooth muscle contraction. Role of RGD peptides. J Surg Res. 2010 Apr;159(2):755-64.
48	Dopamine/serotonin receptor ligands. 9. Oxygen-containing midsized heterocyclic ring systems and nonrigidized analogues. A step toward dopamine D5 ... J Med Chem. 2004 Aug 12;47(17):4155-8.
49	[The benzamides tiapride, sulpiride, and amisulpride in treatment for Tourette's syndrome]. Nervenarzt. 2007 Mar;78(3):264, 266-8, 270-1.
50	In vitro and in vivo characteristics of prochlorperazine oral disintegrating film. Int J Pharm. 2009 Feb 23;368(1-2):98-102.
51	Cetirizine/pseudoephedrine. Drugs. 2001;61(15):2231-40; discussion 2241-2.
52	Receptor reserve-dependent properties of antipsychotics at human dopamine D2 receptors. Eur J Pharmacol. 2009 Apr 1;607(1-3):35-40.
53	Effect of dopamine receptor agonists on sensory nerve activity: possible therapeutic targets for the treatment of asthma and COPD. Br J Pharmacol. 2002 Jun;136(4):620-8.
54	Randomized clinical comparison of perospirone and risperidone in patients with schizophrenia: Kansai Psychiatric Multicenter Study. Psychiatry Clin Neurosci. 2009 Jun;63(3):322-8.
55	The treatment of Tourette's syndrome: current opinions. Expert Opin Pharmacother. 2002 Jul;3(7):899-914.
56	Antiemetic specificity of dopamine antagonists. Psychopharmacology (Berl). 1982;78(3):210-3.
57	Antipsychotics lack alpha 1A/B adrenoceptor subtype selectivity in the rat. Eur Neuropsychopharmacol. 2005 Mar;15(2):231-4.
58	Dopaminergic stimulation of cAMP accumulation in cultured rat mesangial cells. Am J Physiol. 1987 Aug;253(2 Pt 2):H358-64.
59	Comparative effects of tolazoline and nitroprusside on human isolated radial artery. Ann Thorac Surg. 2006 Jan;81(1):125-31.
60	Striatal and extrastriatal D2/D3-receptor-binding properties of ziprasidone: a positron emission tomography study with [18F]Fallypride and [11C]raclopride (D2/D3-receptor occupancy of ziprasidone). JClin Psychopharmacol. 2008 Dec;28(6):608-17.
61	An ethopharmacological assessment of the effects of zuclopenthixol on agonistic interactions in male mice. Methods Find Exp Clin Pharmacol. 1999 Jan-Feb;21(1):11-5.
62	Effects of talipexole on emesis-related changes in abdominal afferent vagal activity and ileal serotonin metabolism in rats. Res Commun Mol Pathol Pharmacol. 1997 Jan;95(1):67-82.
63	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
64	The antiparkinsonian activity of CQA 206-291, a new D2 dopamine receptor agonist. Clin Neuropharmacol. 1989 Feb;12(1):55-9.
65	Discovery of Nonracemic Amisulpride to Maximize Benefit/Risk of 5-HT7 and D2 Receptor Antagonism for the Treatment of Mood Disorders. Clin Pharmacol Ther. 2021 Sep;110(3):808-815.
66	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
67	Pharmacology of pramipexole, a dopamine D3-preferring agonist useful in treating Parkinson's disease. Clin Neuropharmacol. 1998 May-Jun;21(3):141-51.
68	Efficacy and safety of the dopaminergic stabilizer Pridopidine (ACR16) in patients with Huntington's disease. Clin Neuropharmacol. 2010 Sep-Oct;33(5):260-4.
69	Population pharmacokinetics and prediction of dopamine D2 receptor occupancy after multiple doses of RBP-7000, a new sustained-release formulation of risperidone, in schizophrenia patients on stable oral risperidone treatment. Clin Pharmacokinet. 2014 Jun;53(6):533-43.
70	Clinical pipeline report, company report or official report of Lundbeck.
71	Dual ligands targeting dopamine D2 and serotonin 5-HT1A receptors as new antipsychotical or anti-Parkinsonian agents.Curr Med Chem.2014;21(4):437-57.
72	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 215).
73	BIM-23A760, a chimeric molecule directed towards somatostatin and dopamine receptors, vs universal somatostatin receptors ligands in GH-secreting pituitary adenomas partial responders to octreotide. J Endocrinol Invest. 2005;28(11 Suppl International):21-7.
74	Biochemical and pharmacological characterization of the putative dopamine autoreceptor agonist benzopyranopyridine, CGS 15873A. Article first published online: 5 OCT 2004.
75	Clinical pipeline report, company report or official report of Clera Inc.
76	Population pharmacokinetics of JNJ-37822681, a selective fast-dissociating dopamine D receptor antagonist, in healthy subjects and subjects with schizophrenia and dose selection based on simulated D receptor occupancy. Clin Pharmacokinet. 2013 Nov;52(11):1005-15.
77	Pharmacological profile of the new potent neuroleptic ocaperidone (R 79,598). J Pharmacol Exp Ther. 1992 Jan;260(1):146-59.
78	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
79	Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92.
80	Anxiolytic effects of dopamine receptor ligands: I. Involvement of dopamine autoreceptors. Life Sci. 1998;62(7):649-63.
81	Indolebutylamines as selective 5-HT(1A) agonists. J Med Chem. 2004 Sep 9;47(19):4677-83.
82	Drug Development in Schizophrenia: Summary and Table. Pharmaceutical Medicine October 2014, Volume 28, Issue 5, pp 265-271
83	DOI: 10.1038/sj.mp.4002062
84	ClinicalTrials.gov (NCT03543410) A Clinical Study to Test the Effectiveness of an Investigational Drug to Treat People That Have Major Depressive Episodes When They Have Bipolar 1 Depression. U.S. National Institutes of Health.
85	Safety, Pharmacokinetics, and Pharmacodynamics of Trazpiroben (TAK-906), a Novel Selective D 2 /D 3 Receptor Antagonist: A Phase 1 Randomized, Placebo-Controlled Single- and Multiple-Dose Escalation Study in Healthy Participants. Clin Pharmacol Drug Dev. 2021 Jan 18.
86	TBR-760, a Dopamine-Somatostatin Compound, Arrests Growth of Aggressive Nonfunctioning Pituitary Adenomas in Mice. Endocrinology. 2020 Aug 1;161(8):bqaa101.
87	Double-blind study of the actively transported levodopa prodrug XP21279 in Parkinson's disease. Mov Disord. 2014 Jan;29(1):75-82.
88	7-[3-(1-piperidinyl)propoxy]chromenones as potential atypical antipsychotics. 2. Pharmacological profile of 7-[3-[4-(6-fluoro-1, 2-benzisoxazol-3-yl)-piperidin-1-yl]propoxy]-3-(hydroxymeth yl)chromen -4-one (abaperidone, FI-8602). J Med Chem. 1998 Dec 31;41(27):5402-9.
89	Pharmacological characteristics of ATI-9242, a Novel Atypical Antipsychotic. FASEB J, April, 2010, 24(Meeting Abstract Supplement),773.12.
90	Neurohumoral response to carmoxirole, a selective dopamine (D2) receptor agonist, in patients with chronic moderate heart failure. Cardiovasc Drugs Ther. 1998 Sep;12(4):387-94.
91	Clinical pipeline report, company report or official report of Lundbeck
92	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031195)
93	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031909)
94	ONC206, an Imipridone Derivative, Induces Cell Death Through Activation of the Integrated Stress Response in Serous Endometrial Cancer In Vitro. Front Oncol. 2020 Oct 20;10:577141.
95	Bi-directional modulation of BNST neurons by 5-HT: Molecular expression and functional properties of excitatory 5-HT receptor subtypes. Neuroscience. 2009 December 29; 164(4): 1776-1793.
96	SSR181507, a dopamine D receptor and 5-HT() receptor ligand: evidence for mixed anxiolytic- and antidepressant-like activities.Pharmacol Biochem Behav.2011 Jan;97(3):428-35.
97	The effects of umespirone as a potential anxiolytic and antipsychotic agent. Pharmacol Biochem Behav. 1991 Sep;40(1):89-96.
98	Modeling of brain D2 receptor occupancy-plasma concentration relationships with a novel antipsychotic, YKP1358, using serial PET scans in healthy volunteers. Clin Pharmacol Ther. 2007 Feb;81(2):252-8.
99	5-HT1A receptor ligands and their therapeutic applications: review of new patents.Expert Opin Ther Pat. 2018 Sep;28(9):679-689.
100	Progress in the development of histamine H3 receptor antagonists/inverse agonists: a patent review (2013-2017).Expert Opin Ther Pat. 2018 Mar;28(3):175-196.
101	Novel serotonin receptor 2 (5-HT2R) agonists and antagonists: a patent review (2004-2014).Expert Opin Ther Pat. 2016;26(1):89-106.
102	Dopamine uptake inhibiting versus dopamine releasing properties of fencamfamine: an in vitro study. Biochem Pharmacol. 1983 Aug 1;32(15):2329-31.
103	A role for medial prefrontal dopaminergic innervation in instrumental conditioning. J Neurosci. 2009 May 20;29(20):6599-606.
104	Pharmacologically induced, subsecond dopamine transients in the caudate-putamen of the anesthetized rat. Synapse. 2007 Jan;61(1):37-9.
105	Effect of sertindole on extracellular dopamine, acetylcholine, and glutamate in the medial prefrontal cortex of conscious rats: a comparison with r... Psychopharmacology (Berl). 2009 Sep;206(1):39-49.
106	Bifeprunox: a partial agonist at dopamine D2 and serotonin 1A receptors, influences nicotine-seeking behaviour in response to drug-associated stimuli in rats.Addict Biol.2012 Mar;17(2):274-86.
107	Emerging drugs for bipolar disorder. Expert Opin Emerg Drugs. 2006 Nov;11(4):621-34.
108	Effect of nolomirole on monocrotaline-induced heart failure. Pharmacol Res. 2004 Jan;49(1):1-5.
109	The role of the novel D2/beta2-agonist, Viozan (sibenadet HCl), in the treatment of symptoms of chronic obstructive pulmonary disease: results of a... Respir Med. 2003 Jan;97 Suppl A:S23-33.
110	3-Benzisothiazolylpiperazine derivatives as potential atypical antipsychotic agents. J Med Chem. 1996 Jan 5;39(1):143-8.
111	Therapeutic effects of dopamine D1/D2 receptor agonists on detrusor hyperreflexia in 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine-lesioned parkinso... J Pharmacol Exp Ther. 1998 Jul;286(1):228-33.
112	Pharmacokinetics and central nervous system toxicity of declopramide (3-chloroprocainamide) in rats and mice. Anticancer Drugs. 1999 Jan;10(1):79-88.
113	Development of dopaminergic drugs for the chronic treatment of congestive heart failure. J Auton Pharmacol. 1990;10 Suppl 1:s85-93.
114	A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. J Med Chem. 1994 Apr 15;37(8):1060-2.
115	Comparison between the pharmacology of dopamine receptors mediating the inhibition of cell firing in rat brain slices through the substantia nigra pars compacta and ventral tegmental area. Br J Pharmacol. 1994 Jul;112(3):873-80.
116	CA patent application no. 648479, Implants for the treatment of dopamine associated states.
117	Savoxepine: striatal dopamine-D2 receptor occupancy in human volunteers measured using positron emission tomography (PET). Eur J Clin Pharmacol. 1993;44(2):135-40.
118	SLV310, a novel, potential antipsychotic, combining potent dopamine D2 receptor antagonism with serotonin reuptake inhibition. Bioorg Med Chem Lett. 2003 Feb 10;13(3):405-8.
119	Clinical pipeline report, company report or official report of Avarx.
120	A comparison of the neuro-endocrinological and temperature effects of DU 29894, flesinoxan, sulpiride and haloperidol in normal volunteers. Br J Clin Pharmacol. 1995 Jan;39(1):7-14.
121	The dopaminergic stabilizers pridopidine and ordopidine enhance cortico-striatal Arc gene expression. J Neural Transm. 2014 Nov;121(11):1337-47.
122	S18327 (1-[2-[4-(6-fluoro-1, 2-benzisoxazol-3-yl)piperid-1-yl]ethyl]3-phenyl imidazolin-2-one), a novel, potential antipsychotic displaying marked antagonist properties at alpha(1)- and alpha(2)-adrenergic receptors: I. Receptorial, neurochemical, and electrophysiological profile. J Pharmacol Exp Ther. 2000 Jan;292(1):38-53.
123	SDZ GLC 756, a novel octahydrobenzo[g]quinoline derivative exerts opposing effects on dopamine D1 and D2 receptors. J Neural Transm. 1996;103(1-2):17-30.
124	Synthesis and dual D2 and 5-HT1A receptor binding affinities of 7-piperazinyl and 7-piperidinyl-3,4-dihydroquinazolin-2(1H)-ones. Med Chem. 2014;10(5):484-96.
125	F15063, a potential antipsychotic with dopamine D(2)/D(3) antagonist, 5-HT(1A) agonist and D(4) partial agonist properties: (IV) duration of brain D2-like receptor occupancy and antipsychotic-like activity versus plasma concentration in mice.Naunyn Schmiedebergs Arch Pharmacol.2007 Jun;375(4):241-50.
126	Schizophrenia, "just the facts" 5. Treatment and prevention. Past, present, and future. Schizophr Res. 2010 Sep;122(1-3):1-23.
127	S32504, a novel naphtoxazine agonist at dopamine D3/D2 receptors: II. Actions in rodent, primate, and cellular models of antiparkinsonian activity ... J Pharmacol Exp Ther. 2004 Jun;309(3):921-35.
128	(1R,3S)-1-(aminomethyl)-3,4-dihydro-5,6-dihydroxy-3-phenyl-1H-2-benzopyran: a potent and selective D1 agonist. J Med Chem. 1990 Nov;33(11):2948-50.
129	Designed multiple ligands. An emerging drug discovery paradigm. J Med Chem. 2005 Oct 20;48(21):6523-43.
130	ACP-103, a 5-HT2A/2C inverse agonist, potentiates haloperidol-induced dopamine release in rat medial prefrontal cortex and nucleus accumbens. Psychopharmacology (Berl). 2005 Dec;183(2):144-53.
131	BIMG 80, a novel potential antipsychotic drug: evidence for multireceptor actions and preferential release of dopamine in prefrontal cortex. J Neurochem. 1997 Jul;69(1):182-90.
132	CGP 25454A, a novel and selective presynaptic dopamine autoreceptor antagonist. Naunyn Schmiedebergs Arch Pharmacol. 1994 Sep;350(3):230-8.
133	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025558)
134	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009126)
135	WO patent application no. 2009,0568,11, Medicaments.
136	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005079)
137	Dopamine D4 receptors in human postmortem brain tissue of normal and schizophrenic subjects. An [3]NGD-94-1 study. Schizophrenia Research Volume 29, Issues 1-2, January 1998, Pages 93.
138	NNC-19-1228 and NNC 22-0031, novel neuroleptics with a "mesolimbic-selective" behavioral profile. Psychopharmacology (Berl). 1997 Jan;129(2):168-78.
139	Synthesis and pharmacological evaluation of the enantiomers of the dopamine autoreceptor agonist PD 135385, Bioorg. Med. Chem. Lett. 3(4):639-644 (1993).
140	The dopamine stabilizer (-)-OSU6162 occupies a subpopulation of striatal dopamine D2/D3 receptors: an [(11)C]raclopride PET study in healthy human subjects. Neuropsychopharmacology. 2015 Jan;40(2):472-9.
141	Piperazinylalkyl heterocycles as potential antipsychotic agents. J Med Chem. 1995 Oct 13;38(21):4198-210.
142	Development and validation of a capillary electrophoresis method for the enantiomeric purity determination of SLV307, a basic potential antipsychotic compound. Electrophoresis. 2004 Aug;25(16):2854-9.
143	Neuroleptic properties of Y-20024, a new benzofurancarboxamide derivative. Nihon Yakurigaku Zasshi. 1989 Nov;94(5):269-80.
144	Displacement activity of bisbenzylisoquinoline alkaloids at striatal 3H-SCH 23390 and 3H-raclopride binding sites. J Nat Prod. 1992 Sep;55(9):1281-6.
145	Synthesis and structure-activity relationships of 1-aralkyl-4-benzylpiperidine and 1-aralkyl-4-benzylpiperazine derivatives as potent sigma ligands. J Med Chem. 2005 Jan 13;48(1):266-73.
146	Functional correlates of dopamine D3 receptor activation in the rat in vivo and their modulation by the selective antagonist, (+)-S 14297: 1. Activation of postsynaptic D3 receptors mediates hypothermia, whereas blockade of D2 receptors elicits prolactin secretion and catalepsy. J Pharmacol Exp Ther. 1995 Nov;275(2):885-98.
147	Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31.
148	Substituted 3-phenylpiperidines: new centrally acting dopamine autoreceptor antagonists. J Med Chem. 1993 Oct 15;36(21):3188-96.
149	Conjugated enynes as nonaromatic catechol bioisosteres: synthesis, binding experiments, and computational studies of novel dopamine receptor agonis... J Med Chem. 2000 Feb 24;43(4):756-62.
150	Specific targeting of peripheral serotonin 5-HT(3) receptors. Synthesis, biological investigation, and structure-activity relationships. J Med Chem. 2009 Jun 11;52(11):3548-62.
151	3-amino-3,4-dihydro-2H-1-benzopyran derivatives as 5-HT1A receptor ligands and potential anxiolytic agents. 2. Synthesis and quantitative structure... J Med Chem. 1996 Oct 11;39(21):4285-98.
152	Synthesis and dopamine receptor selectivity of the benzyltetrahydroisoquinoline, (R)-(+)-nor-roefractine. J Nat Prod. 1998 Jun 26;61(6):709-12.
153	R-(-)-N-alkyl-11-hydroxy-10-hydroxymethyl- and 10-methyl-aporphines as 5-HT1A receptor ligands. Bioorg Med Chem Lett. 2007 Aug 1;17(15):4128-30.
154	Synthesis and dopamine receptor affinities of N-alkyl-11-hydroxy-2-methoxynoraporphines: N-alkyl substituents determine D1 versus D2 receptor selec... J Med Chem. 2008 Feb 28;51(4):983-7.
155	Synthesis and neuropharmacological evaluation of 2-aryl- and alkylapomorphines. Bioorg Med Chem. 2008 Apr 1;16(7):3773-9.
156	Advances in development of dopaminergic aporphinoids. J Med Chem. 2007 Jan 25;50(2):171-81.
157	Synthesis and dopamine receptor affinities of enantiomers of 2-substituted apomorphines and their N-n-propyl analogues. J Med Chem. 1990 Jun;33(6):1800-5.
158	Synthesis and neuropharmacological characterization of 2-O-substituted apomorphines. Bioorg Med Chem. 2008 Apr 15;16(8):4563-8.
159	Discovery of bishomo(hetero)arylpiperazines as novel multifunctional ligands targeting dopamine D(3) and serotonin 5-HT(1A) and 5-HT(2A) receptors. J Med Chem. 2010 Jun 24;53(12):4803-7.
160	Synthesis and evaluation of a set of 4-phenylpiperidines and 4-phenylpiperazines as D2 receptor ligands and the discovery of the dopaminergic stabi... J Med Chem. 2010 Mar 25;53(6):2510-20.
161	Synthesis and biological investigations of dopaminergic partial agonists preferentially recognizing the D4 receptor subtype. Bioorg Med Chem Lett. 2006 Jun 1;16(11):2955-9.
162	Synthesis of novel lactam derivatives and their evaluation as ligands for the dopamine receptors, leading to a D(4)-selective ligand. Bioorg Med Chem. 2007 Sep 1;15(17):5811-8.
163	Arylmethyloxyphenyl derivatives: small molecules displaying P-glycoprotein inhibition. J Med Chem. 2006 Nov 2;49(22):6607-13.
164	Synthesis and pharmacological evaluation of 1-(aminomethyl)-3,4-dihydro-5-hydroxy-1H-2-benzopyrans as dopamine D1 selective ligands. J Med Chem. 1991 Oct;34(10):2946-53.
165	Piperidinylpyrroles: design, synthesis and binding properties of novel and selective dopamine D4 receptor ligands. Bioorg Med Chem Lett. 1999 Nov 1;9(21):3143-6.
166	Affinity of 10-(4-methylpiperazino)dibenz[b,f]oxepins for clozapine and spiroperidol binding sites in rat brain. J Med Chem. 1982 Jul;25(7):855-8.
167	D4 dopamine receptor-selective compounds from the Chinese plant Phoebe chekiangensis, Bioorg. Med. Chem. Lett. 7(9):1207-1212 (1997).
168	Regioselective synthesis of 3-aryl substituted pyrrolidines via palladium catalyzed arylation: pharmacological evaluation for central dopaminergic and serotonergic activity, Bioorg. Med. Chem. Lett. 7(3):241-246 (1997).
169	New N-n-propyl-substituted 3-aryl- and 3-cyclohexylpiperidines as partial agonists at the D4 dopamine receptor. J Med Chem. 2003 Jan 2;46(1):161-8.
170	Synthesis and evaluation of 1,2,3,4-tetrahydro[1]benzothieno[2,3-h]isoquinolines as dopamine antagonists. J Med Chem. 1981 Sep;24(9):1107-10.
171	Halogenated boldine derivatives with enhanced monoamine receptor selectivity. J Nat Prod. 2000 Apr;63(4):480-4.
172	N-n-Propyl-substituted 3-(dimethylphenyl)piperidines display novel discriminative properties between dopamine receptor subtypes: synthesis and rece... J Med Chem. 1998 Dec 3;41(25):4933-8.
173	New generation dopaminergic agents. 7. Heterocyclic bioisosteres that exploit the 3-OH-phenoxyethylamine D2 template. Bioorg Med Chem Lett. 1999 Sep 6;9(17):2593-8.
174	New generation dopaminergic agents. 5. Heterocyclic bioisosteres that exploit the 3-OH-N1-phenylpiperazine dopaminergic template. Bioorg Med Chem Lett. 1998 Oct 6;8(19):2675-80.
175	3-((4-(4-Chlorophenyl)piperazin-1-yl)-methyl)-1H-pyrrolo-2,3-b-pyridine: an antagonist with high affinity and selectivity for the human dopamine D4... J Med Chem. 1996 May 10;39(10):1941-2.
176	Pre- and postsynaptic dopaminergic activities of indolizidine and quinolizidine derivatives of 3-(3-hydroxyphenyl)-N-(n-propyl)piperidine (3-PPP). ... J Med Chem. 1990 Mar;33(3):1015-22.
177	6-Hydroxy-3-n-propyl-2,3,4,5-tetrahydro-1H-3-benzazepine and analogs: new centrally acting 5-HT1A receptor agonists. J Med Chem. 1992 Oct 30;35(22):3984-90.
178	Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97.
179	Development of (S)-N6-(2-(4-(isoquinolin-1-yl)piperazin-1-yl)ethyl)-N6-propyl-4,5,6,7-tetrahydrobenzo[d]-thiazole-2,6-diamine and its analogue as a... J Med Chem. 2010 Feb 11;53(3):1023-37.
180	Synthesis and evaluation of non-catechol D-1 and D-2 dopamine receptor agonists: benzimidazol-2-one, benzoxazol-2-one, and the highly potent benzot... J Med Chem. 1987 Jul;30(7):1166-76.
181	Iodinated 2-aminotetralins and 3-amino-1-benzopyrans: ligands for dopamine D2 and D3 receptors. J Med Chem. 1994 Nov 25;37(24):4245-50.
182	Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: 1H-pyrimidin-2-one derivatives. Bioorg Med Chem Lett. 2006 Feb;16(3):490-4.
183	Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: Quinolin(di)one and benzazepin(di)one derivatives. herve.genes... Bioorg Med Chem Lett. 2006 Feb;16(3):658-62.
184	Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54.
185	Evaluation of the effects of the enantiomers of reduced haloperidol, azaperol, and related 4-amino-1-arylbutanols on dopamine and sigma receptors. J Med Chem. 1993 Nov 26;36(24):3929-36.
186	Synthesis and structure-affinity relationships of novel N-(1-ethyl-4-methylhexahydro-1,4-diazepin-6-yl)pyridine-3-carboxamides with potent serotoni... J Med Chem. 2003 Feb 27;46(5):702-15.
187	18F-labeled benzamides for studying the dopamine D2 receptor with positron emission tomography. J Med Chem. 1993 Nov 12;36(23):3707-20.
188	Bioisosteric heterocyclic versions of 7-{[2-(4-phenyl-piperazin-1-yl)ethyl]propylamino}-5,6,7,8-tetrahydronaphthalen-2-ol: identification of highly... J Med Chem. 2008 May 22;51(10):3005-19.
189	Structurally constrained hybrid derivatives containing octahydrobenzo[g or f]quinoline moieties for dopamine D2 and D3 receptors: binding character... J Med Chem. 2008 Dec 25;51(24):7806-19.
190	Investigation of various N-heterocyclic substituted piperazine versions of 5/7-{[2-(4-aryl-piperazin-1-yl)-ethyl]-propyl-amino}-5,6,7,8-tetrahydro-... Bioorg Med Chem. 2009 Jun 1;17(11):3923-33.
191	Further delineation of hydrophobic binding sites in dopamine D(2)/D(3) receptors for N-4 substituents on the piperazine ring of the hybrid template... Bioorg Med Chem. 2010 Aug 1;18(15):5661-74.
192	Fluorinated and iodinated dopamine agents: D2 imaging agents for PET and SPECT. J Med Chem. 1993 Jan 22;36(2):221-8.
193	Substituted 5-amino-4,5,6,7-tetrahydroindazoles as partial ergoline structures with dopaminergic activity. J Med Chem. 1989 Oct;32(10):2388-96.
194	Potential antipsychotic agents 5. Synthesis and antidopaminergic properties of substituted 5,6-dimethoxysalicylamides and related compounds. J Med Chem. 1990 Apr;33(4):1155-63.
195	2-Phenylpyrroles as conformationally restricted benzamide analogues. A new class of potential antipsychotics. 1. J Med Chem. 1987 Nov;30(11):2099-104.
196	Synthesis and pharmacological evaluation of a series of 4-piperazinylpyrazolo[3,4-b]- and -[4,3-b][1,5]benzodiazepines as potential anxiolytics. J Med Chem. 1989 Dec;32(12):2573-82.
197	Neuroleptic activity in 5-aryltetrahydro-gamma-carbolines. J Med Chem. 1980 Jun;23(6):635-43.
198	Synthesis and pharmacological evaluation of triflate-substituted analogues of clozapine: identification of a novel atypical neuroleptic. J Med Chem. 1997 Dec 5;40(25):4146-53.
199	Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain. J Med Chem. 1981 Sep;24(9):1021-6.
200	Synthesis and characterization of selective dopamine D2 receptor antagonists. 2. Azaindole, benzofuran, and benzothiophene analogs of L-741,626. Bioorg Med Chem. 2010 Jul 15;18(14):5291-300.
201	Structure-activity relationship study on N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides, a class of 5-HT7 receptor agents. 2. J Med Chem. 2007 Aug 23;50(17):4214-21.
202	Structural modifications of N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides: influence on lipophilicity and 5-HT7 receptor act... J Med Chem. 2008 Sep 25;51(18):5813-22.
203	Synthesis and neuropharmacological evaluation of esters of R(-)-N-alkyl-11-hydroxy-2-methoxynoraporphines. Bioorg Med Chem Lett. 2009 Jan 1;19(1):51-3.
204	Discovery, optimization, and characterization of a novel series of dopamine D2 versus D3 receptor selective antagonists. Probe Reports from the NIH Molecular Libraries Program [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2010.
205	Discovery and characterization of a G protein-biased agonist that inhibits beta-arrestin recruitment to the D2 dopamine receptor. Mol Pharmacol. 2014 Jul;86(1):96-105.
206	Novel D3 selective dopaminergics incorporating enyne units as nonaromatic catechol bioisosteres: synthesis, bioactivity, and mutagenesis studies. J Med Chem. 2008 Nov 13;51(21):6829-38.
207	N-Substituted-2-alkyl- and 2-arylnorapomorphines: novel, highly active D2 agonists. Bioorg Med Chem. 2009 Jul 1;17(13):4756-62.
208	A functional test identifies dopamine agonists selective for D3 versus D2 receptors. Neuroreport. 1995 Jan 26;6(2):329-32.
209	Nafadotride, a potent preferential dopamine D3 receptor antagonist, activates locomotion in rodents. J Pharmacol Exp Ther. 1995 Dec;275(3):1239-46.
210	Exploring the neuroleptic substituent in octoclothepin: potential ligands for positron emission tomography with subnanomolar affinity for (1)-adre... J Med Chem. 2010 Oct 14;53(19):7021-34.
211	Neurochemical and functional characterization of the preferentially selective dopamine D3 agonist PD 128907. J Pharmacol Exp Ther. 1995 Dec;275(3):1355-66.
212	Isoindolinone enantiomers having affinity for the dopamine D4 receptor. Bioorg Med Chem Lett. 1998 Jun 16;8(12):1499-502.
213	Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3... J Med Chem. 2007 Aug 23;50(17):4135-46.
214	Differential actions of antiparkinson agents at multiple classes of monoaminergic receptor. I. A multivariate analysis of the binding profiles of 14 drugs at 21 native and cloned human receptor subtypes. J Pharmacol Exp Ther. 2002 Nov;303(2):791-804.
215	Evaluation of cis- and trans-9- and 11-hydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridines as structurally rigid, selective D1 dopamine recepto... J Med Chem. 1995 Jan 20;38(2):318-27.
216	4-Acetoxy-7-chloro-3-(3-(-4-[11C]methoxybenzyl)phenyl)-2(1H)-quinolone Molecular Imaging and Contrast Agent Database (MICAD) [Internet].
217	Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54.
218	Atropisomeric derivatives of 2',6'-disubstituted (R)-11-phenylaporphine: selective serotonin 5-HT(7) receptor antagonists. J Med Chem. 2001 Apr 26;44(9):1337-40.
219	Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43.
220	A new mechanism of allostery in a G protein-coupled receptor dimer. Nat Chem Biol. 2014 Sep;10(9):745-52.
221	Synthesis and pharmacological characterization of 1-phenyl-, 4-phenyl-, and 1-benzyl-1,2,3,4-tetrahydroisoquinolines as dopamine receptor ligands. J Med Chem. 1988 Oct;31(10):1941-6.
222	Effects of the partial dopamine receptor agonists SDZ 208-911, SDZ 208-912 and terguride on central monoamine receptors. A behavioral, biochemical and electrophysiological study. Naunyn SchmiedebergsArch Pharmacol. 1991 Sep;344(3):263-74.
223	trans-10,11-dihydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridine: a highly potent selective dopamine D1 full agonist. J Med Chem. 1990 Jun;33(6):1756-64.
224	Synthesis, structure-activity relationships, and biological properties of 1-heteroaryl-4-[omega-(1H-indol-3-yl)alkyl]piperazines, novel potential a... J Med Chem. 2005 Nov 3;48(22):6855-69.
225	Synthesis and SAR investigations for novel melanin-concentrating hormone 1 receptor (MCH1) antagonists part 2: A hybrid strategy combining key frag... J Med Chem. 2007 Aug 9;50(16):3883-90.
226	Dibenzazecine scaffold rebuilding--is the flexibility always essential for high dopamine receptor affinities Bioorg Med Chem. 2009 Oct 1;17(19):6898-907.
227	(Dipropylamino)-tetrahydronaphthofurans: centrally acting serotonin agonists and dopamine agonists-antagonists, Bioorg. Med. Chem. Lett. 7(21):2759-2764 (1997).
228	N-[2-[(substituted chroman-8-yl)oxy]ethyl]-4-(4-methoxyphenyl)butylamines: synthesis and wide range of antagonism at the human 5-HT1A receptor. J Med Chem. 1997 Apr 11;40(8):1252-7.
229	Discovery of beta-arrestin-biased dopamine D2 ligands for probing signal transduction pathways essential for antipsychotic efficacy. Proc Natl Acad Sci U S A. 2011 Nov 8;108(45):18488-93.
230	Novel 1-aminoethyl-3-arylsulfonyl-1H-pyrrolo[2,3-b]pyridines are potent 5-HT(6) agonists. Bioorg Med Chem. 2009 Jul 15;17(14):5153-63.
231	Nonconserved residues in the second transmembrane-spanning domain of the D(4) dopamine receptor are molecular determinants of D(4)-selective pharmacology. Mol Pharmacol. 2000 Jan;57(1):144-52.
232	Regulation of human D(1), d(2(long)), d(2(short)), D(3) and D(4) dopamine receptors by amiloride and amiloride analogues. Br J Pharmacol. 2000 Jul;130(5):1045-59.