Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT23NON8)

DOT Name C-C motif chemokine 1 (CCL1)
Synonyms Small-inducible cytokine A1; T lymphocyte-secreted protein I-309
Gene Name CCL1
Related Disease
Carcinoma of esophagus ( )
Chronic obstructive pulmonary disease ( )
Esophageal cancer ( )
Glomerulonephritis ( )
Neoplasm of esophagus ( )
Pulmonary tuberculosis ( )
Adenocarcinoma ( )
Adult T-cell leukemia/lymphoma ( )
Advanced cancer ( )
Alzheimer disease ( )
Analgesia ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Atopic dermatitis ( )
Bladder cancer ( )
Breast cancer ( )
Chronic pancreatitis ( )
Colorectal carcinoma ( )
Diabetic kidney disease ( )
Endometriosis ( )
Esophageal squamous cell carcinoma ( )
Invasive breast carcinoma ( )
Kaposi sarcoma ( )
Lung adenocarcinoma ( )
Multiple sclerosis ( )
Neoplasm ( )
Neuralgia ( )
Pancreatic adenocarcinoma ( )
Pancreatic cancer ( )
Pancreatitis ( )
Pulmonary hypertension ( )
Rheumatoid arthritis ( )
Sarcoidosis ( )
T-cell leukaemia ( )
Tuberculosis ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Asthma ( )
Hepatocellular carcinoma ( )
Interstitial nephritis ( )
Methicillin-resistant staphylococci infection ( )
Non-hodgkin lymphoma ( )
Bacterial infection ( )
Breast carcinoma ( )
Latent tuberculosis infection ( )
Lymphoma ( )
Malaria ( )
Nervous system inflammation ( )
Squamous cell carcinoma ( )
UniProt ID
CCL1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1EL0; 4OIJ; 4OIK
Pfam ID
PF00048
Sequence
MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNE
GLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Function Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8.
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
Viral protein interaction with cytokine and cytokine receptor (hsa04061 )
Chemokine sig.ling pathway (hsa04062 )
Reactome Pathway
G alpha (i) signalling events (R-HSA-418594 )
Chemokine receptors bind chemokines (R-HSA-380108 )

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Carcinoma of esophagus DISS6G4D Definitive Genetic Variation [1]
Chronic obstructive pulmonary disease DISQCIRF Definitive Altered Expression [2]
Esophageal cancer DISGB2VN Definitive Genetic Variation [1]
Glomerulonephritis DISPZIQ3 Definitive Biomarker [3]
Neoplasm of esophagus DISOLKAQ Definitive Genetic Variation [1]
Pulmonary tuberculosis DIS6FLUM Definitive Genetic Variation [4]
Adenocarcinoma DIS3IHTY Strong Altered Expression [2]
Adult T-cell leukemia/lymphoma DIS882XU Strong Biomarker [5]
Advanced cancer DISAT1Z9 Strong Genetic Variation [6]
Alzheimer disease DISF8S70 Strong Biomarker [7]
Analgesia DISK3TVI Strong Biomarker [8]
Arteriosclerosis DISK5QGC Strong Biomarker [9]
Atherosclerosis DISMN9J3 Strong Biomarker [9]
Atopic dermatitis DISTCP41 Strong Biomarker [10]
Bladder cancer DISUHNM0 Strong Altered Expression [11]
Breast cancer DIS7DPX1 Strong Biomarker [12]
Chronic pancreatitis DISBUOMJ Strong Genetic Variation [13]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [14]
Diabetic kidney disease DISJMWEY Strong Biomarker [15]
Endometriosis DISX1AG8 Strong Biomarker [16]
Esophageal squamous cell carcinoma DIS5N2GV Strong Genetic Variation [6]
Invasive breast carcinoma DISANYTW Strong Altered Expression [12]
Kaposi sarcoma DISC1H1Z Strong Biomarker [17]
Lung adenocarcinoma DISD51WR Strong Biomarker [2]
Multiple sclerosis DISB2WZI Strong Biomarker [18]
Neoplasm DISZKGEW Strong Biomarker [19]
Neuralgia DISWO58J Strong Biomarker [20]
Pancreatic adenocarcinoma DISKHX7S Strong Genetic Variation [13]
Pancreatic cancer DISJC981 Strong Biomarker [13]
Pancreatitis DIS0IJEF Strong Genetic Variation [13]
Pulmonary hypertension DIS1RSP5 Strong Biomarker [21]
Rheumatoid arthritis DISTSB4J Strong Biomarker [22]
Sarcoidosis DISE5B8Z Strong Altered Expression [23]
T-cell leukaemia DISJ6YIF Strong Biomarker [5]
Tuberculosis DIS2YIMD Strong Genetic Variation [4]
Urinary bladder cancer DISDV4T7 Strong Altered Expression [11]
Urinary bladder neoplasm DIS7HACE Strong Altered Expression [11]
Asthma DISW9QNS moderate Biomarker [24]
Hepatocellular carcinoma DIS0J828 moderate Biomarker [19]
Interstitial nephritis DISKQGND moderate Biomarker [25]
Methicillin-resistant staphylococci infection DIS6DRDZ moderate Biomarker [26]
Non-hodgkin lymphoma DISS2Y8A moderate Genetic Variation [27]
Bacterial infection DIS5QJ9S Limited Altered Expression [28]
Breast carcinoma DIS2UE88 Limited Biomarker [12]
Latent tuberculosis infection DIS6R1EH Limited Altered Expression [29]
Lymphoma DISN6V4S Limited Biomarker [30]
Malaria DISQ9Y50 Limited Altered Expression [31]
Nervous system inflammation DISB3X5A Limited Genetic Variation [32]
Squamous cell carcinoma DISQVIFL Limited Genetic Variation [33]
------------------------------------------------------------------------------------
⏷ Show the Full List of 49 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of C-C motif chemokine 1 (CCL1). [34]
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of C-C motif chemokine 1 (CCL1). [35]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of C-C motif chemokine 1 (CCL1). [36]
Dasatinib DMJV2EK Approved Dasatinib decreases the expression of C-C motif chemokine 1 (CCL1). [37]
Clozapine DMFC71L Approved Clozapine decreases the expression of C-C motif chemokine 1 (CCL1). [38]
Malathion DMXZ84M Approved Malathion increases the expression of C-C motif chemokine 1 (CCL1). [39]
ANW-32821 DMMJOZD Phase 2 ANW-32821 increases the expression of C-C motif chemokine 1 (CCL1). [40]
ACYLINE DM9GRTK Phase 2 ACYLINE decreases the expression of C-C motif chemokine 1 (CCL1). [41]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of C-C motif chemokine 1 (CCL1). [42]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of C-C motif chemokine 1 (CCL1). [43]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of C-C motif chemokine 1 (CCL1). [45]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)
1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the secretion of C-C motif chemokine 1 (CCL1). [44]
------------------------------------------------------------------------------------

References

1 Short tandem repeat polymorphism in exon 4 of esophageal cancer-related gene 2 detected in genomic DNA is a prognostic marker for esophageal cancer.Am J Surg. 2007 Sep;194(3):380-4. doi: 10.1016/j.amjsurg.2007.01.026.
2 IL-11 and CCL-1: Novel Protein Diagnostic Biomarkers of Lung Adenocarcinoma in Bronchoalveolar Lavage Fluid (BALF).J Thorac Oncol. 2016 Dec;11(12):2183-2192. doi: 10.1016/j.jtho.2016.07.026. Epub 2016 Aug 12.
3 Effective methylprednisolone dose in experimental crescentic glomerulonephritis.Am J Kidney Dis. 2001 Feb;37(2):411-7. doi: 10.1053/ajkd.2001.21329.
4 Genetic polymorphisms of CCL1 rs2072069 G/A and TLR2 rs3804099 T/C in pulmonary or meningeal tuberculosis patients.Int J Clin Exp Pathol. 2015 Oct 1;8(10):12608-20. eCollection 2015.
5 Autocrine antiapoptotic stimulation of cultured adult T-cell leukemia cells by overexpression of the chemokine I-309.Blood. 2001 Aug 15;98(4):1150-9. doi: 10.1182/blood.v98.4.1150.
6 Short tandem repeat polymorphism in a novel esophageal cancer-related gene (ECRG2) implicates susceptibility to esophageal cancer in Chinese population.Int J Cancer. 2004 Jan 10;108(2):232-6. doi: 10.1002/ijc.11560.
7 Altered levels of blood proteins in Alzheimer's disease longitudinal study: Results from Australian Imaging Biomarkers Lifestyle Study of Ageing cohort.Alzheimers Dement (Amst). 2017 Apr 23;8:60-72. doi: 10.1016/j.dadm.2017.04.003. eCollection 2017.
8 The Systemic Administration of the Chemokine CCL1 Evokes Thermal Analgesia in Mice Through the Activation of the Endocannabinoid System.Cell Mol Neurobiol. 2019 Nov;39(8):1115-1124. doi: 10.1007/s10571-019-00706-3. Epub 2019 Jun 15.
9 Disruption of the CCL1-CCR8 axis inhibits vascular Treg recruitment and function and promotes atherosclerosis in mice.J Mol Cell Cardiol. 2019 Jul;132:154-163. doi: 10.1016/j.yjmcc.2019.05.009. Epub 2019 May 21.
10 A Molluscum contagiosum fusion protein inhibits CCL1-induced chemotaxis of cells expressing CCR8 and penetrates human neonatal foreskins: clinical applications proposed.Arch Dermatol Res. 2015 Apr;307(3):275-80. doi: 10.1007/s00403-014-1516-0. Epub 2014 Nov 11.
11 Long noncoding RNAGAS5 acts as a tumor suppressor in bladder transitional cell carcinoma via regulation of chemokine (CC motif) ligand 1 expression.Mol Med Rep. 2016 Jan;13(1):27-34. doi: 10.3892/mmr.2015.4503. Epub 2015 Nov 5.
12 CCL1 is a major regulatory T cell attracting factor in human breast cancer.BMC Cancer. 2018 Dec 20;18(1):1278. doi: 10.1186/s12885-018-5117-8.
13 Short tandem repeat polymorphisms of exon 4 in Kazal-type gene ECRG2 in pancreatic carcinoma and chronic pancreatitis.Anticancer Res. 2007 Jan-Feb;27(1A):69-73.
14 Participation of CCL1 in Snail-Positive Fibroblasts in Colorectal Cancer Contribute to 5-Fluorouracil/Paclitaxel Chemoresistance.Cancer Res Treat. 2018 Jul;50(3):894-907. doi: 10.4143/crt.2017.356. Epub 2017 Sep 18.
15 Activity of Group 2 Innate Lymphoid Cells is Associated with Chronic Inflammation and Dysregulated Metabolic Homoeostasis in Type 2 Diabetic Nephropathy.Scand J Immunol. 2018 Feb;87(2):99-107. doi: 10.1111/sji.12637. Epub 2018 Jan 3.
16 Elevated serum chemokines are independently associated with both endometriosis and uranium exposure.Reprod Toxicol. 2019 Mar;84:26-31. doi: 10.1016/j.reprotox.2018.12.006. Epub 2018 Dec 21.
17 Crystal structure of viral macrophage inflammatory protein I encoded by Kaposi's sarcoma-associated herpesvirus at 1.7A.J Mol Biol. 2005 Oct 7;352(5):1019-28. doi: 10.1016/j.jmb.2005.08.011.
18 The CC chemokine ligand (CCL) 1, upregulated by the viral transactivator Tax, can be downregulated by minocycline: possible implications for long-term treatment of HTLV-1-associated myelopathy/tropical spastic paraparesis.Virol J. 2017 Dec 4;14(1):234. doi: 10.1186/s12985-017-0902-6.
19 Peritumoural CCL1 and CCL22 expressing cells in hepatocellular carcinomas shape the tumour immune infiltrate.Pathology. 2019 Oct;51(6):586-592. doi: 10.1016/j.pathol.2019.06.001. Epub 2019 Aug 21.
20 miR-21-5p inhibits neuropathic pain development via directly targeting C-C motif ligand 1 and tissue inhibitor of metalloproteinase-3.J Cell Biochem. 2019 Oct;120(10):16614-16623. doi: 10.1002/jcb.28920. Epub 2019 Jun 3.
21 Resveratrol downregulates acute pulmonary thromboembolism-induced pulmonary artery hypertension via p38 mitogen-activated protein kinase and monocyte chemoattractant protein-1 signaling in rats.Life Sci. 2012 May 22;90(19-20):721-7. doi: 10.1016/j.lfs.2012.03.008. Epub 2012 Apr 1.
22 An initial investigation into endothelial CC chemokine expression in the human rheumatoid synovium.Cytokine. 2017 Sep;97:133-140. doi: 10.1016/j.cyto.2017.05.023.
23 Comparison of the chemokine profiles in the bronchoalveolar lavage fluid between IgG4-related respiratory disease and sarcoidosis: CC-chemokine ligand 1 might be involved in the pathogenesis of sarcoidosis.Cytokine. 2019 Aug;120:125-129. doi: 10.1016/j.cyto.2019.04.017. Epub 2019 May 4.
24 CC chemokine ligand 1 is released into the airways of atopic asthmatics.Eur Respir J. 2006 Jul;28(1):59-67. doi: 10.1183/09031936.06.00134304. Epub 2006 Mar 15.
25 Gene expression of CC chemokines in experimental acute tubulointerstitial nephritis.J Lab Clin Med. 1999 Jan;133(1):41-7. doi: 10.1053/lc.1999.v133.a94726.
26 Macrophage polarization and MRSA infection in burned mice.Immunol Cell Biol. 2017 Feb;95(2):198-206. doi: 10.1038/icb.2016.84. Epub 2016 Sep 6.
27 Single-nucleotide polymorphisms in genes encoding for CC chemokines were not associated with the risk of non-Hodgkin lymphoma.Cancer Epidemiol Biomarkers Prev. 2013 Jul;22(7):1332-5. doi: 10.1158/1055-9965.EPI-13-0328. Epub 2013 May 2.
28 Changes in Chemokines and Chemokine Receptors Expression in a Mouse Model of Alzheimer's Disease.Int J Biol Sci. 2019 Jan 1;15(2):453-463. doi: 10.7150/ijbs.26703. eCollection 2019.
29 Malnutrition is associated with diminished baseline and mycobacterial antigen - stimulated chemokine responses in latent tuberculosis infection.J Infect. 2018 Nov;77(5):410-416. doi: 10.1016/j.jinf.2018.05.003. Epub 2018 May 17.
30 CCR8-dependent activation of the RAS/MAPK pathway mediates anti-apoptotic activity of I-309/ CCL1 and vMIP-I.Eur J Immunol. 2003 Feb;33(2):494-501. doi: 10.1002/immu.200310025.
31 Host response to malaria during pregnancy: placental monocyte recruitment is associated with elevated beta chemokine expression.J Immunol. 2003 Mar 1;170(5):2759-64. doi: 10.4049/jimmunol.170.5.2759.
32 Sequence polymorphisms in the chemokines Scya1 (TCA-3), Scya2 (monocyte chemoattractant protein (MCP)-1), and Scya12 (MCP-5) are candidates for eae7, a locus controlling susceptibility to monophasic remitting/nonrelapsing experimental allergic encephalomyelitis.J Immunol. 1999 Aug 15;163(4):2262-6.
33 Short tandem repeat polymorphism in exon 4 of esophageal cancer related gene 2 predicts relapse of oral squamous cell carcinoma.Oral Oncol. 2008 Feb;44(2):143-7. doi: 10.1016/j.oraloncology.2007.01.013. Epub 2007 Apr 5.
34 Chemokine induction by all-trans retinoic acid and arsenic trioxide in acute promyelocytic leukemia: triggering the differentiation syndrome. Blood. 2009 Dec 24;114(27):5512-21. doi: 10.1182/blood-2009-02-204834. Epub 2009 Oct 14.
35 Pattern of expression of apoptosis and inflammatory genes in humans exposed to arsenic and/or fluoride. Sci Total Environ. 2010 Jan 15;408(4):760-7. doi: 10.1016/j.scitotenv.2009.11.016. Epub 2009 Dec 4.
36 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
37 Dasatinib, a small-molecule protein tyrosine kinase inhibitor, inhibits T-cell activation and proliferation. Blood. 2008 Feb 1;111(3):1366-77. doi: 10.1182/blood-2007-04-084814. Epub 2007 Oct 25.
38 Histamine H4 receptor agonists have more activities than H4 agonism in antigen-specific human T-cell responses. Immunology. 2007 Jun;121(2):266-75. doi: 10.1111/j.1365-2567.2007.02574.x. Epub 2007 Mar 7.
39 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
40 Human Mincle Binds to Cholesterol Crystals and Triggers Innate Immune Responses. J Biol Chem. 2015 Oct 16;290(42):25322-32. doi: 10.1074/jbc.M115.645234. Epub 2015 Aug 20.
41 Intraprostatic androgens and androgen-regulated gene expression persist after testosterone suppression: therapeutic implications for castration-resistant prostate cancer. Cancer Res. 2007 May 15;67(10):5033-41.
42 Aryl hydrocarbon receptor- and calcium-dependent induction of the chemokine CCL1 by the environmental contaminant benzo[a]pyrene. J Biol Chem. 2006 Jul 21;281(29):19906-15. doi: 10.1074/jbc.M601192200. Epub 2006 May 5.
43 Inhibition of Super-Enhancer Activity in Autoinflammatory Site-Derived T Cells Reduces Disease-Associated Gene Expression. Cell Rep. 2015 Sep 29;12(12):1986-96. doi: 10.1016/j.celrep.2015.08.046. Epub 2015 Sep 17.
44 Ni(II) ions dysregulate cytokine secretion from human monocytes. J Biomed Mater Res B Appl Biomater. 2009 Feb;88(2):358-65. doi: 10.1002/jbm.b.31063.
45 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.