Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT38EQT6)

• DOT Name: DnaJ homolog subfamily B member 9 (DNAJB9)
• Synonyms: Endoplasmic reticulum DNA J domain-containing protein 4; ER-resident protein ERdj4; ERdj4; Microvascular endothelial differentiation gene 1 protein; Mdg-1
• Gene Name: DNAJB9
• Related Disease:
  Amyloidosis
  Cardiovascular disease
  Cholestasis
  Glomerulonephritis
  Hyperlipidemia
  Obesity
  Parkinson disease
  Fatty liver disease
  Fetal growth restriction
  Non-alcoholic fatty liver disease
  Amyotrophic lateral sclerosis
  Chronic renal failure
  End-stage renal disease
  Type-1/2 diabetes
• UniProt ID: DNJB9_HUMAN
• PDB ID: 2CTR
• Pfam ID: PF00226
• Sequence:
  MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKS
  PDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFK
  DFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFS
  GFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ
• Function: Co-chaperone for Hsp70 protein HSPA5/BiP that acts as a key repressor of the ERN1/IRE1-mediated unfolded protein response (UPR). J domain-containing co-chaperones stimulate the ATPase activity of Hsp70 proteins and are required for efficient substrate recognition by Hsp70 proteins. In the unstressed endoplasmic reticulum, interacts with the luminal region of ERN1/IRE1 and selectively recruits HSPA5/BiP: HSPA5/BiP disrupts the dimerization of the active ERN1/IRE1 luminal region, thereby inactivating ERN1/IRE1. Also involved in endoplasmic reticulum-associated degradation (ERAD) of misfolded proteins. Required for survival of B-cell progenitors and normal antibody production.
• Tissue Specificity: Widely expressed. Expressed at highest level in the liver, placenta and kidney .
• Reactome Pathway: XBP1(S) activates chaperone genes (R-HSA-381038)

Molecular Interaction Atlas (MIA) of This DOT

14 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Amyloidosis	DISHTAI2	Strong	Biomarker	[1]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[2]
Cholestasis	DISDJJWE	Strong	Biomarker	[3]
Glomerulonephritis	DISPZIQ3	Strong	Altered Expression	[4]
Hyperlipidemia	DIS61J3S	Strong	Biomarker	[5]
Obesity	DIS47Y1K	Strong	Biomarker	[5]
Parkinson disease	DISQVHKL	Strong	Biomarker	[6]
Fatty liver disease	DIS485QZ	moderate	Biomarker	[5]
Fetal growth restriction	DIS5WEJ5	moderate	Biomarker	[7]
Non-alcoholic fatty liver disease	DISDG1NL	moderate	Altered Expression	[5]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Altered Expression	[8]
Chronic renal failure	DISGG7K6	Limited	Biomarker	[9]
End-stage renal disease	DISXA7GG	Limited	Biomarker	[9]
Type-1/2 diabetes	DISIUHAP	Limited	Altered Expression	[10]

44 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[11]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[12]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[13]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[14]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[15]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[16]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[17]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[18]
Marinol	DM70IK5	Approved	Marinol increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[19]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[20]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[21]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[22]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[19]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[18]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[23]
Mifepristone	DMGZQEF	Approved	Mifepristone increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[24]
Ifosfamide	DMCT3I8	Approved	Ifosfamide increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[23]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[23]
Thalidomide	DM70BU5	Approved	Thalidomide increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[25]
Bicalutamide	DMZMSPF	Approved	Bicalutamide increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[26]
Nefazodone	DM4ZS8M	Approved	Nefazodone increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[27]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[28]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[29]
Isoflavone	DM7U58J	Phase 4	Isoflavone increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[30]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[31]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[32]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[33]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[34]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[35]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[36]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[37]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[38]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[39]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[11]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[40]
Milchsaure	DM462BT	Investigative	Milchsaure affects the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[41]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[42]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[43]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[44]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[45]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[46]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[47]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[48]
L-Serine	DM6WPIS	Investigative	L-Serine increases the expression of DnaJ homolog subfamily B member 9 (DNAJB9).	[49]

References

• [1] Congophilic Fibrillary Glomerulonephritis: A Case Series.Am J Kidney Dis. 2018 Sep;72(3):325-336. doi: 10.1053/j.ajkd.2018.03.017. Epub 2018 Jun 14.
• [2] MDG? inhibits H2O2induced apoptosis and inflammation in human umbilical vein endothelial cells.Mol Med Rep. 2017 Sep;16(3):3673-3679. doi: 10.3892/mmr.2017.6957. Epub 2017 Jul 12.
• [3] Classification of Cholestatic and Necrotic Hepatotoxicants Using Transcriptomics on Human Precision-Cut Liver Slices.Chem Res Toxicol. 2016 Mar 21;29(3):342-51. doi: 10.1021/acs.chemrestox.5b00491. Epub 2016 Mar 9.
• [4] Serum levels of DNAJB9 are elevated in fibrillaryglomerulonephritis patients.Kidney Int. 2019 May;95(5):1269-1272. doi: 10.1016/j.kint.2019.01.024. Epub 2019 Mar 1.
• [5] MDG-1, an Ophiopogon polysaccharide, restrains process of non-alcoholic fatty liver disease via modulating the gut-liver axis.Int J Biol Macromol. 2019 Dec 1;141:1013-1021. doi: 10.1016/j.ijbiomac.2019.09.007. Epub 2019 Sep 3.
• [6] Integrated Analysis of Whole Exome Sequencing and Copy Number Evaluation in Parkinson's Disease.Sci Rep. 2019 Mar 4;9(1):3344. doi: 10.1038/s41598-019-40102-x.
• [7] The exposure to uteroplacental insufficiency is associated with activation of unfolded protein response in postnatal life.PLoS One. 2018 Jun 13;13(6):e0198490. doi: 10.1371/journal.pone.0198490. eCollection 2018.
• [8] Amyotrophic lateral sclerosis (ALS) and Alzheimer's disease (AD) are characterised by differential activation of ER stress pathways: focus on UPR target genes.Cell Stress Chaperones. 2018 Sep;23(5):897-912. doi: 10.1007/s12192-018-0897-y. Epub 2018 May 4.
• [9] Heavy Chain Fibrillary Glomerulonephritis: A Case Report.Am J Kidney Dis. 2019 Aug;74(2):276-280. doi: 10.1053/j.ajkd.2019.01.032. Epub 2019 Apr 5.
• [10] MDG-1, a Potential Regulator of PPAR and PPAR, Ameliorates Dyslipidemia in Mice.Int J Mol Sci. 2017 Sep 8;18(9):1930. doi: 10.3390/ijms18091930.
• [11] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [12] Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
• [13] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [14] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [15] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [16] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [17] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [18] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [19] Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
• [20] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [21] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [22] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [23] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [24] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [25] Polyunsaturated fatty acids synergize with lipid droplet binding thalidomide analogs to induce oxidative stress in cancer cells. Lipids Health Dis. 2010 Jun 2;9:56. doi: 10.1186/1476-511X-9-56.
• [26] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [27] Robustness testing and optimization of an adverse outcome pathway on cholestatic liver injury. Arch Toxicol. 2020 Apr;94(4):1151-1172. doi: 10.1007/s00204-020-02691-9. Epub 2020 Mar 10.
• [28] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [29] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [30] Soy isoflavones exert differential effects on androgen responsive genes in LNCaP human prostate cancer cells. J Nutr. 2007 Apr;137(4):964-72.
• [31] Molecular mechanisms of action of angiopreventive anti-oxidants on endothelial cells: microarray gene expression analyses. Mutat Res. 2005 Dec 11;591(1-2):198-211.
• [32] Curcumin downregulates the inflammatory cytokines CXCL1 and -2 in breast cancer cells via NFkappaB. Carcinogenesis. 2008 Apr;29(4):779-89.
• [33] Using DNA microarray analyses to elucidate the effects of genistein in androgen-responsive prostate cancer cells: identification of novel targets. Mol Carcinog. 2004 Oct;41(2):108-119.
• [34] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [35] Expression of endogenous retroviruses reflects increased usage of atypical enhancers in T cells. EMBO J. 2019 Jun 17;38(12):e101107. doi: 10.15252/embj.2018101107. Epub 2019 May 8.
• [36] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [37] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [38] Protective effect against Parkinson's disease-related insults through the activation of XBP1. Brain Res. 2009 Feb 27;1257:16-24. doi: 10.1016/j.brainres.2008.11.104. Epub 2008 Dec 16.
• [39] The genomic response of Ishikawa cells to bisphenol A exposure is dose- and time-dependent. Toxicology. 2010 Apr 11;270(2-3):137-49. doi: 10.1016/j.tox.2010.02.008. Epub 2010 Feb 17.
• [40] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
• [41] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [42] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [43] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [44] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [45] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [46] CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.
• [47] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [48] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [49] Mechanisms of L-Serine Neuroprotection in vitro Include ER Proteostasis Regulation. Neurotox Res. 2018 Jan;33(1):123-132. doi: 10.1007/s12640-017-9829-3. Epub 2017 Nov 2.