Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3F75WA)

• DOT Name: Insulin receptor-related protein (INSRR)
• Synonyms: IRR; EC 2.7.10.1; IR-related receptor
• Gene Name: INSRR
• Related Disease:
  Neuroblastoma
  Alzheimer disease
  Anemia
  Anxiety disorder
  Atrial fibrillation
  Breast cancer
  Breast carcinoma
  Cardiac failure
  Chronic kidney disease
  Chronic obstructive pulmonary disease
  Clear cell renal carcinoma
  Colorectal carcinoma
  Congestive heart failure
  Crohn disease
  Dementia
  Depression
  Hepatitis B virus infection
  Hepatitis C virus infection
  High blood pressure
  HIV infectious disease
  Lung cancer
  Lung carcinoma
  Malaria
  Mental disorder
  Multiple sclerosis
  Neoplasm
  Non-insulin dependent diabetes
  Osteoarthritis
  Pneumonia
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
  Stroke
  Systemic lupus erythematosus
  Tuberculosis
  Ulcerative colitis
  Cardiovascular disease
  Rheumatoid arthritis
  Anxiety
  Advanced cancer
  Asthma
  Attention deficit hyperactivity disorder
  Hepatocellular carcinoma
  Inflammatory bowel disease
  Metastatic malignant neoplasm
  Myocardial infarction
  Psychotic disorder
  Schizophrenia
• UniProt ID: INSRR_HUMAN
• PDB ID: 7PL4; 7TYJ; 7TYK; 7TYM
• EC Number: 2.7.10.1
• Pfam ID: PF00757 ; PF07714 ; PF01030
• Sequence:
  MAVPSLWPWGACLPVIFLSLGFGLDTVEVCPSLDIRSEVAELRQLENCSVVEGHLQILLM
  FTATGEDFRGLSFPRLTQVTDYLLLFRVYGLESLRDLFPNLAVIRGTRLFLGYALVIFEM
  PHLRDVALPALGAVLRGAVRVEKNQELCHLSTIDWGLLQPAPGANHIVGNKLGEECADVC
  PGVLGAAGEPCAKTTFSGHTDYRCWTSSHCQRVCPCPHGMACTARGECCHTECLGGCSQP
  EDPRACVACRHLYFQGACLWACPPGTYQYESWRCVTAERCASLHSVPGRASTFGIHQGSC
  LAQCPSGFTRNSSSIFCHKCEGLCPKECKVGTKTIDSIQAAQDLVGCTHVEGSLILNLRQ
  GYNLEPQLQHSLGLVETITGFLKIKHSFALVSLGFFKNLKLIRGDAMVDGNYTLYVLDNQ
  NLQQLGSWVAAGLTIPVGKIYFAFNPRLCLEHIYRLEEVTGTRGRQNKAEINPRTNGDRA
  ACQTRTLRFVSNVTEADRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGT
  QSWNLLDVELPLSRTQEPGVTLASLKPWTQYAVFVRAITLTTEEDSPHQGAQSPIVYLRT
  LPAAPTVPQDVISTSNSSSHLLVRWKPPTQRNGNLTYYLVLWQRLAEDGDLYLNDYCHRG
  LRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNA
  ITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDFEIQEDKVPRERAVLSGLRHF
  TEYRIDIHACNHAAHTVGCSAATFVFARTMPHREADGIPGKVAWEASSKNSVLLRWLEPP
  DPNGLILKYEIKYRRLGEEATVLCVSRLRYAKFGGVHLALLPPGNYSARVRATSLAGNGS
  WTDSVAFYILGPEEEDAGGLHVLLTATPVGLTLLIVLAALGFFYGKKRNRTLYASVNPEY
  FSASDMYVPDEWEVPREQISIIRELGQGSFGMVYEGLARGLEAGEESTPVALKTVNELAS
  PRECIEFLKEASVMKAFKCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSHLRSLRPEAEN
  NPGLPQPALGEMIQMAGEIADGMAYLAANKFVHRDLAARNCMVSQDFTVKIGDFGMTRDV
  YETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQ
  VLKFVMDGGVLEELEGCPLQLQELMSRCWQPNPRLRPSFTHILDSIQEELRPSFRLLSFY
  YSPECRGARGSLPTTDAEPDSSPTPRDCSPQNGGPGH
• Function: Receptor with tyrosine-protein kinase activity. Functions as a pH sensing receptor which is activated by increased extracellular pH. Activates an intracellular signaling pathway that involves IRS1 and AKT1/PKB.
• KEGG Pathway:
  Regulation of actin cytoskeleton (hsa04810)
  Prostate cancer (hsa05215)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neuroblastoma	DISVZBI4	Definitive	Altered Expression	[1]
Alzheimer disease	DISF8S70	Strong	Biomarker	[2]
Anemia	DISTVL0C	Strong	Genetic Variation	[3]
Anxiety disorder	DISBI2BT	Strong	Genetic Variation	[4]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[5]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[6]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[6]
Cardiac failure	DISDC067	Strong	Genetic Variation	[7]
Chronic kidney disease	DISW82R7	Strong	Biomarker	[8]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Biomarker	[9]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[10]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[11]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[9]
Crohn disease	DIS2C5Q8	Strong	Biomarker	[12]
Dementia	DISXL1WY	Strong	Biomarker	[13]
Depression	DIS3XJ69	Strong	Biomarker	[4]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[14]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[15]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[16]
HIV infectious disease	DISO97HC	Strong	Biomarker	[17]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[18]
Lung carcinoma	DISTR26C	Strong	Genetic Variation	[18]
Malaria	DISQ9Y50	Strong	Biomarker	[19]
Mental disorder	DIS3J5R8	Strong	Biomarker	[20]
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[21]
Neoplasm	DISZKGEW	Strong	Altered Expression	[22]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[23]
Osteoarthritis	DIS05URM	Strong	Genetic Variation	[24]
Pneumonia	DIS8EF3M	Strong	Genetic Variation	[25]
Prostate cancer	DISF190Y	Strong	Genetic Variation	[17]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[17]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[10]
Stroke	DISX6UHX	Strong	Biomarker	[26]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[27]
Tuberculosis	DIS2YIMD	Strong	Genetic Variation	[28]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[12]
Cardiovascular disease	DIS2IQDX	moderate	Genetic Variation	[6]
Rheumatoid arthritis	DISTSB4J	moderate	Biomarker	[29]
Anxiety	DISIJDBA	Disputed	Genetic Variation	[30]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[8]
Asthma	DISW9QNS	Limited	Biomarker	[31]
Attention deficit hyperactivity disorder	DISL8MX9	Limited	Biomarker	[2]
Hepatocellular carcinoma	DIS0J828	Limited	Genetic Variation	[32]
Inflammatory bowel disease	DISGN23E	Limited	Biomarker	[4]
Metastatic malignant neoplasm	DIS86UK6	Limited	Genetic Variation	[33]
Myocardial infarction	DIS655KI	Limited	Genetic Variation	[7]
Psychotic disorder	DIS4UQOT	Limited	Genetic Variation	[34]
Schizophrenia	DISSRV2N	No Known	Unknown	[35]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Insulin receptor-related protein (INSRR).	[36]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Insulin receptor-related protein (INSRR).	[37]

References

• [1] Coexpression of insulin receptor-related receptor and insulin-like growth factor 1 receptor correlates with enhanced apoptosis and dedifferentiation in human neuroblastomas.Clin Cancer Res. 2003 Nov 15;9(15):5683-92.
• [2] Antecedent ADHD, dementia, and metabolic dysregulation: A U.S. based cohort analysis.Neurochem Int. 2018 Jan;112:255-258. doi: 10.1016/j.neuint.2017.08.005. Epub 2017 Aug 12.
• [3] Predictors of Recurrent Hospitalizations and the Importance of These Hospitalizations for Subsequent Mortality After Incident Transient Ischemic Attack.J Stroke Cerebrovasc Dis. 2019 Jan;28(1):167-174. doi: 10.1016/j.jstrokecerebrovasdis.2018.09.028. Epub 2018 Oct 17.
• [4] Increased Burden of Psychiatric Disorders in Inflammatory Bowel Disease.Inflamm Bowel Dis. 2019 Jan 10;25(2):360-368. doi: 10.1093/ibd/izy235.
• [5] Impact of intravenous thrombolysis on length of hospital stay in cases of acute ischemic stroke.Neuropsychiatr Dis Treat. 2018 Jan 9;14:259-264. doi: 10.2147/NDT.S151836. eCollection 2018.
• [6] Psychiatric disorders and cardiovascular diseases during the diagnostic workup of potential breast cancer: a population-based cohort study in Skne, Sweden.Breast Cancer Res. 2019 Dec 10;21(1):139. doi: 10.1186/s13058-019-1232-y.
• [7] Increasing trends in hospitalisations due to atrial fibrillation in Australia from 1993 to 2013.Heart. 2019 Sep;105(17):1358-1363. doi: 10.1136/heartjnl-2018-314471. Epub 2019 Apr 1.
• [8] Elements of Palliative Care in the Last 6Months of Life: Frequency, Predictors, and Timing.J Gen Intern Med. 2020 Mar;35(3):753-761. doi: 10.1007/s11606-019-05349-0. Epub 2019 Oct 24.
• [9] Risk of Severe Influenza Among Adults With Chronic Medical Conditions.J Infect Dis. 2020 Jan 2;221(2):183-190. doi: 10.1093/infdis/jiz570.
• [10] Hyper-interleukin-11 novel designer molecular adjuvant targeting gp130 for whole cell cancer vaccines.Expert Opin Biol Ther. 2011 Dec;11(12):1555-67. doi: 10.1517/14712598.2011.627852. Epub 2011 Oct 14.
• [11] Hospitalization Rates and Predictors of Rehospitalization Among Individuals With Advanced Cancer in the Year After Diagnosis.J Clin Oncol. 2017 Nov 1;35(31):3610-3617. doi: 10.1200/JCO.2017.72.4963. Epub 2017 Aug 29.
• [12] Population Density and Risk of Inflammatory Bowel Disease: A Prospective Population-Based Study in 13 Countries or Regions in Asia-Pacific.Am J Gastroenterol. 2019 Jan;114(1):107-115. doi: 10.1038/s41395-018-0233-2.
• [13] Impact of Coexisting Overactive Bladder in Medicare Patients With Dementia on Clinical and Economic Outcomes.Am J Alzheimers Dis Other Demen. 2019 Nov-Dec;34(7-8):492-499. doi: 10.1177/1533317519841164. Epub 2019 Apr 9.
• [14] Incident Hepatitis B Virus Infection in HIV-Infected and HIV-Uninfected Men Who Have Sex With Men From Pre-HAART to HAART Periods: A Cohort Study.Ann Intern Med. 2015 Nov 3;163(9):673-80. doi: 10.7326/M15-0547. Epub 2015 Oct 13.
• [15] History of Marijuana Use Does Not Affect Outcomes on the Liver Transplant Waitlist.Transplantation. 2018 May;102(5):794-802. doi: 10.1097/TP.0000000000002045.
• [16] Privately insured adults in HDHP with higher deductibles reduce rates of primary care and preventive services.Transl Behav Med. 2018 May 23;8(3):375-385. doi: 10.1093/tbm/ibx076.
• [17] Racial differences in prostate cancer risk in young HIV-positive and HIV-negative men: a prospective cohort study.Cancer Causes Control. 2017 Jul;28(7):767-777. doi: 10.1007/s10552-017-0896-9. Epub 2017 Apr 27.
• [18] Gender differences and lung cancer risk in occupational chefs: analyzing more than 350,000 chefs in Taiwan, 1984-2011.Int Arch Occup Environ Health. 2019 Jan;92(1):101-109. doi: 10.1007/s00420-018-1358-8. Epub 2018 Sep 18.
• [19] Use of anthropophilic culicid-based xenosurveillance as a proxy for Plasmodium vivax malaria burden and transmission hotspots identification.PLoS Negl Trop Dis. 2018 Nov 12;12(11):e0006909. doi: 10.1371/journal.pntd.0006909. eCollection 2018 Nov.
• [20] Interactions between psychiatric and physical disorders and their effects on the risks of suicide: a nested case-control study.Ann N Y Acad Sci. 2020 Feb;1462(1):79-91. doi: 10.1111/nyas.14216. Epub 2019 Sep 8.
• [21] The impact of treatment adherence on clinical and economic outcomes in multiple sclerosis: Real world evidence from Alberta, Canada.Mult Scler Relat Disord. 2017 Nov;18:218-224. doi: 10.1016/j.msard.2017.10.001. Epub 2017 Oct 6.
• [22] Correlation of type I insulin-like growth factor receptor (IGF-I-R) and insulin receptor-related receptor (IRR) messenger RNA levels in tumor cell lines from pediatric tumors of neuronal origin.Regul Pept. 1999 Oct 22;84(1-3):37-42. doi: 10.1016/s0167-0115(99)00065-8.
• [23] Type 2 diabetes increases the risk of hospital admission for heart failure and reduces the risk of in hospital mortality in Spain (2001-2015).Eur J Intern Med. 2019 Jan;59:53-59. doi: 10.1016/j.ejim.2018.08.011. Epub 2018 Aug 22.
• [24] Incident osteoarthritis and osteoarthritis-related joint replacement surgery in patients with ankylosing spondylitis: A secondary cohort analysis of a nationwide, population-based health claims database.PLoS One. 2017 Nov 2;12(11):e0187594. doi: 10.1371/journal.pone.0187594. eCollection 2017.
• [25] Mortality, disability, and healthcare expenditure of patients with seropositive rheumatoid arthritis in Korea: A nationwide population-based study.PLoS One. 2019 Jan 8;14(1):e0210471. doi: 10.1371/journal.pone.0210471. eCollection 2019.
• [26] Transfemoral Carotid Artery Stents Should Be Used with Caution in Patients with Asymptomatic Carotid Artery Stenosis.Ann Vasc Surg. 2019 Jan;54:1-11. doi: 10.1016/j.avsg.2018.10.001. Epub 2018 Oct 17.
• [27] High Health Care Utilization Preceding Diagnosis of Systemic Lupus Erythematosus in Youth.Arthritis Care Res (Hoboken). 2018 Sep;70(9):1303-1311. doi: 10.1002/acr.23485. Epub 2018 Aug 16.
• [28] Epidemiology and outcome of HIV patients in Finland co-infected with tuberculosis 1998-2015.BMC Infect Dis. 2019 Mar 18;19(1):264. doi: 10.1186/s12879-019-3890-x.
• [29] Increased Burden of Psychiatric Disorders in Rheumatoid Arthritis.Arthritis Care Res (Hoboken). 2018 Jul;70(7):970-978. doi: 10.1002/acr.23539. Epub 2018 May 21.
• [30] Patients with overlapping diagnoses of asthma and COPD: is livestock exposure a risk factor for comorbidity and coexisting symptoms and infections?.BMC Pulm Med. 2019 Jun 10;19(1):105. doi: 10.1186/s12890-019-0865-z.
• [31] Recurrent Acute Chest Syndrome in Pediatric Sickle Cell Disease: Clinical Features and Risk Factors.J Pediatr Hematol Oncol. 2018 Jan;40(1):51-55. doi: 10.1097/MPH.0000000000001012.
• [32] Ambient PM(2.5) air pollutionexposure and hepatocellular carcinoma incidence in the United States.Cancer Causes Control. 2018 Jun;29(6):563-572. doi: 10.1007/s10552-018-1036-x. Epub 2018 Apr 25.
• [33] Screening for Prostate Cancer Starting at Age 50-54 Years. A Population-based Cohort Study.Eur Urol. 2017 Jan;71(1):46-52. doi: 10.1016/j.eururo.2016.03.026. Epub 2016 Apr 13.
• [34] High rates of general practice attendance by former prisoners: a prospective cohort study.Med J Aust. 2017 Jul 17;207(2):75-80. doi: 10.5694/mja16.00841.
• [35] Large-Scale Exome Sequencing Study Implicates Both Developmental and Functional Changes in the Neurobiology of Autism. Cell. 2020 Feb 6;180(3):568-584.e23. doi: 10.1016/j.cell.2019.12.036. Epub 2020 Jan 23.
• [36] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [37] Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.