Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4G5CIK)

• DOT Name: Calcineurin-binding protein cabin-1 (CABIN1)
• Synonyms: Calcineurin inhibitor; CAIN
• Gene Name: CABIN1
• Related Disease:
  Renal fibrosis
  Atopic dermatitis
  Autoimmune disease
  B-cell neoplasm
  Breast cancer
  Breast carcinoma
  Chronic renal failure
  Clear cell renal carcinoma
  Congestive heart failure
  Crohn disease
  Dementia
  Depression
  Encephalitis
  End-stage renal disease
  Graft-versus-host disease
  Hepatitis C virus infection
  Hepatocellular carcinoma
  High blood pressure
  Idiopathic nephrotic syndrome
  IgA nephropathy
  Inflammatory bowel disease
  Kidney cancer
  Kidney failure
  Liver cirrhosis
  Lupus nephritis
  Myelodysplastic syndrome
  Nephropathy
  Nephrotic syndrome
  Renal cell carcinoma
  Skin cancer
  Status epilepticus seizure
  Systemic lupus erythematosus
  Thrombotic microangiopathy
  Tuberculosis
  Vascular disease
  Plasma cell myeloma
  Urinary tract infection
  Arthritis
  Metastatic malignant neoplasm
  Neuroblastoma
  Small-cell lung cancer
  Advanced cancer
  Amyotrophic lateral sclerosis
  Chronic kidney disease
  Dermatomyositis
  Neoplasm
  Neurofibromatosis
  Rheumatoid arthritis
  Squamous cell carcinoma
  Type-1/2 diabetes
• UniProt ID: CABIN_HUMAN
• PDB ID: 1N6J
• Pfam ID: PF09047
• Sequence:
  MIRIAALNASSTIEDDHEGSFKSHKTQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYH
  ELLEASLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAMEFYLEAVMLD
  STDVNLWYKIGHVALRLIRIPLARHAFEEGLRCNPDHWPCLDNLITVLYTLSDYTTCLYF
  ICKALEKDCRYSKGLVLKEKIFEEQPCLRKDSLRMFLKCDMSIHDVSVSAAETQAIVDEA
  LGLRKKRQALIVREKEPDLKLVQPIPFFTWKCLGESLLAMYNHLTTCEPPRPSLGKRIDL
  SDYQDPSQPLESSMVVTPVNVIQPSTVSTNPAVAVAEPVVSYTSVATTSFPLHSPGLLET
  GAPVGDISGGDKSKKGVKRKKISEESGETAKRRSARVRNTKCKKEEKVDFQELLMKFLPS
  RLRKLDPEEEDDSFNNYEVQSEAKLESFPSIGPQRLSFDSATFMESEKQDVHEFLLENLT
  NGGILELMMRYLKAMGHKFLVRWPPGLAEVVLSVYHSWRRHSTSLPNPLLRDCSNKHIKD
  MMLMSLSCMELQLDQWLLTKGRSSAVSPRNCPAGMVNGRFGPDFPGTHCLGDLLQLSFAS
  SQRDLFEDGWLEFVVRVYWLKARFLALQGDMEQALENYDICTEMLQSSTAIQVEAGAERR
  DIVIRLPNLHNDSVVSLEEIDKNLKSLERCQSLEEIQRLYEAGDYKAVVHLLRPTLCTSG
  FDRAKHLEFMTSIPERPAQLLLLQDSLLRLKDYRQCFECSDVALNEAVQQMVNSGEAAAK
  EEWVATVTQLLMGIEQALSADSSGSILKVSSSTTGLVRLTNNLIQVIDCSMAVQEEAKEP
  HVSSVLPWIILHRIIWQEEDTFHSLCHQQQLQNPAEEGMSETPMLPSSLMLLNTAHEYLG
  RRSWCCNSDGALLRFYVRVLQKELAASTSEDTHPYKEELETALEQCFYCLYSFPSKKSKA
  RYLEEHSAQQVDLIWEDALFMFEYFKPKTLPEFDSYKTSTVSADLANLLKRIATIVPRTE
  RPALSLDKVSAYIEGTSTEVPCLPEGADPSPPVVNELYYLLADYHFKNKEQSKAIKFYMH
  DICICPNRFDSWAGMALARASRIQDKLNSNELKSDGPIWKHATPVLNCFRRALEIDSSNL
  SLWIEYGTMSYALHSFASRQLKQWRGELPPELVQQMEGRRDSMLETAKHCFTSAARCEGD
  GDEEEWLIHYMLGKVAEKQQQPPTVYLLHYRQAGHYLHEEAARYPKKIHYHNPPELAMEA
  LEVYFRLHASILKLLGKPDSGVGAEVLVNFMKEAAEGPFARGEEKNTPKASEKEKACLVD
  EDSHSSAGTLPGPGASLPSSSGPGLTSPPYTATPIDHDYVKCKKPHQQATPDDRSQDSTA
  VALSDSSSTQDFFNEPTSLLEGSRKSYTEKRLPILSSQAGATGKDLQGATEERGKNEESL
  ESTEGFRAAEQGVQKPAAETPASACIPGKPSASTPTLWDGKKRGDLPGEPVAFPQGLPAG
  AEEQRQFLTEQCIASFRLCLSRFPQHYKSLYRLAFLYTYSKTHRNLQWARDVLLGSSIPW
  QQLQHMPAQGLFCERNKTNFFNGIWRIPVDEIDRPGSFAWHMNRSIVLLLKVLAQLRDHS
  TLLKVSSMLQRTPDQGKKYLRDADRQVLAQRAFILTVKVLEDTLSELAEGSERPGPKVCG
  LPGARMTTDVSHKASPEDGQEGLPQPKKPPLADGSGPGPEPGGKVGLLNHRPVAMDAGDS
  ADQSGERKDKESPRAGPTEPMDTSEATVCHSDLERTPPLLPGRPARDRGPESRPTELSLE
  ELSISARQQPTPLTPAQPAPAPAPATTTGTRAGGHPEEPLSRLSRKRKLLEDTESGKTLL
  LDAYRVWQQGQKGVAYDLGRVERIMSETYMLIKQVDEEAALEQAVKFCQVHLGAAAQRQA
  SGDTPTTPKHPKDSRENFFPVTVVPTAPDPVPADSVQRPSDAHTKPRPALAAATTIITCP
  PSASASTLDQSKDPGPPRPHRPEATPSMASLGPEGEELARVAEGTSFPPQEPRHSPQVKM
  APTSSPAEPHCWPAEAALGTGAEPTCSQEGKLRPEPRRDGEAQEAASETQPLSSPPTAAS
  SKAPSSGSAQPPEGHPGKPEPSRAKSRPLPNMPKLVIPSAATKFPPEITVTPPTPTLLSP
  KGSISEETKQKLKSAILSAQSAANVRKESLCQPALEVLETSSQESSLESETDEDDDYMDI
• Function: May be required for replication-independent chromatin assembly. May serve as a negative regulator of T-cell receptor (TCR) signaling via inhibition of calcineurin. Inhibition of activated calcineurin is dependent on both PKC and calcium signals. Acts as a negative regulator of p53/TP53 by keeping p53 in an inactive state on chromatin at promoters of a subset of it's target genes.
• Tissue Specificity: Widely expressed in different tissues.
• Reactome Pathway: Formation of Senescence-Associated Heterochromatin Foci (SAHF) (R-HSA-2559584)

Molecular Interaction Atlas (MIA) of This DOT

50 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Renal fibrosis	DISMHI3I	Definitive	Biomarker	[1]
Atopic dermatitis	DISTCP41	Strong	Biomarker	[2]
Autoimmune disease	DISORMTM	Strong	Biomarker	[3]
B-cell neoplasm	DISVY326	Strong	Biomarker	[4]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[5]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[5]
Chronic renal failure	DISGG7K6	Strong	Biomarker	[6]
Clear cell renal carcinoma	DISBXRFJ	Strong	Genetic Variation	[7]
Congestive heart failure	DIS32MEA	Strong	Altered Expression	[8]
Crohn disease	DIS2C5Q8	Strong	Biomarker	[9]
Dementia	DISXL1WY	Strong	Biomarker	[10]
Depression	DIS3XJ69	Strong	Biomarker	[11]
Encephalitis	DISLD1RL	Strong	Biomarker	[12]
End-stage renal disease	DISXA7GG	Strong	Biomarker	[6]
Graft-versus-host disease	DIS0QADF	Strong	Genetic Variation	[13]
Hepatitis C virus infection	DISQ0M8R	Strong	Altered Expression	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[15]
High blood pressure	DISY2OHH	Strong	Biomarker	[16]
Idiopathic nephrotic syndrome	DISV4XYG	Strong	Biomarker	[17]
IgA nephropathy	DISZ8MTK	Strong	Biomarker	[18]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[19]
Kidney cancer	DISBIPKM	Strong	Biomarker	[7]
Kidney failure	DISOVQ9P	Strong	Biomarker	[20]
Liver cirrhosis	DIS4G1GX	Strong	Biomarker	[21]
Lupus nephritis	DISCVGPZ	Strong	Biomarker	[22]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[23]
Nephropathy	DISXWP4P	Strong	Biomarker	[24]
Nephrotic syndrome	DISSPSC2	Strong	Biomarker	[25]
Renal cell carcinoma	DISQZ2X8	Strong	Genetic Variation	[7]
Skin cancer	DISTM18U	Strong	Genetic Variation	[26]
Status epilepticus seizure	DISY3BIC	Strong	Biomarker	[27]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[28]
Thrombotic microangiopathy	DISLZ0VW	Strong	Genetic Variation	[29]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[30]
Vascular disease	DISVS67S	Strong	Biomarker	[31]
Plasma cell myeloma	DIS0DFZ0	moderate	Altered Expression	[32]
Urinary tract infection	DISMT6UV	moderate	Biomarker	[33]
Arthritis	DIST1YEL	Disputed	Altered Expression	[34]
Metastatic malignant neoplasm	DIS86UK6	Disputed	Biomarker	[35]
Neuroblastoma	DISVZBI4	Disputed	Biomarker	[36]
Small-cell lung cancer	DISK3LZD	Disputed	Biomarker	[35]
Advanced cancer	DISAT1Z9	Limited	Genetic Variation	[37]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Genetic Variation	[38]
Chronic kidney disease	DISW82R7	Limited	Biomarker	[39]
Dermatomyositis	DIS50C5O	Limited	Biomarker	[40]
Neoplasm	DISZKGEW	Limited	Biomarker	[15]
Neurofibromatosis	DIS5N2R6	Limited	Autosomal dominant	[41]
Rheumatoid arthritis	DISTSB4J	Limited	Biomarker	[42]
Squamous cell carcinoma	DISQVIFL	Limited	Genetic Variation	[26]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[40]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Calcineurin-binding protein cabin-1 (CABIN1).	[43]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Calcineurin-binding protein cabin-1 (CABIN1).	[53]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Calcineurin-binding protein cabin-1 (CABIN1).	[44]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Calcineurin-binding protein cabin-1 (CABIN1).	[45]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Calcineurin-binding protein cabin-1 (CABIN1).	[46]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Calcineurin-binding protein cabin-1 (CABIN1).	[47]
Selenium	DM25CGV	Approved	Selenium increases the expression of Calcineurin-binding protein cabin-1 (CABIN1).	[48]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Calcineurin-binding protein cabin-1 (CABIN1).	[49]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of Calcineurin-binding protein cabin-1 (CABIN1).	[50]
Mifepristone	DMGZQEF	Approved	Mifepristone increases the expression of Calcineurin-binding protein cabin-1 (CABIN1).	[51]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Calcineurin-binding protein cabin-1 (CABIN1).	[52]

References

• [1] Metformin Attenuates Cyclosporine A-induced Renal Fibrosis in Rats.Transplantation. 2019 Oct;103(10):e285-e296. doi: 10.1097/TP.0000000000002864.
• [2] Off-label Uses of Topical Pimecrolimus.J Cutan Med Surg. 2019 Jul/Aug;23(4):442-448. doi: 10.1177/1203475419847950. Epub 2019 May 3.
• [3] The pharmacogenetics of calcineurin inhibitor-related nephrotoxicity.Ther Drug Monit. 2010 Aug;32(4):387-93. doi: 10.1097/FTD.0b013e3181e44244.
• [4] Defibrotide Stimulates Angiogenesis and Protects Endothelial Cells from Calcineurin Inhibitor-Induced Apoptosis via Upregulation of AKT/Bcl-xL.Thromb Haemost. 2018 Jan;118(1):161-173. doi: 10.1160/TH17-04-0275. Epub 2018 Jan 5.
• [5] The role of calcineurin/NFAT in SFRP2 induced angiogenesis--a rationale for breast cancer treatment with the calcineurin inhibitor tacrolimus.PLoS One. 2011;6(6):e20412. doi: 10.1371/journal.pone.0020412. Epub 2011 Jun 3.
• [6] Peritoneal Dialysis in Orthotopic Liver Transplantation Recipients.Perit Dial Int. 2018 Jan-Feb;38(1):44-48. doi: 10.3747/pdi.2017.00134. Epub 2017 Nov 21.
• [7] Honokiol inhibits c-Met-HO-1 tumor-promoting pathway and its cross-talk with calcineurin inhibitor-mediated renal cancer growth.Sci Rep. 2017 Jul 19;7(1):5900. doi: 10.1038/s41598-017-05455-1.
• [8] Increased expression of calpain and elevated activity of calcineurin in the myocardium of patients with congestive heart failure.Int J Mol Med. 2010 Jul;26(1):159-64. doi: 10.3892/ijmm_00000448.
• [9] Safety and Efficacy of Combination Treatment With Calcineurin Inhibitors and Vedolizumab in Patients With Refractory Inflammatory Bowel Disease.Clin Gastroenterol Hepatol. 2019 Feb;17(3):486-493. doi: 10.1016/j.cgh.2018.04.060. Epub 2018 May 8.
• [10] Whole volume brain extraction for multi-centre, multi-disease FLAIR MRI datasets.Magn Reson Imaging. 2020 Feb;66:116-130. doi: 10.1016/j.mri.2019.08.022. Epub 2019 Aug 28.
• [11] Catatonia After Liver Transplantation.Ann Transplant. 2018 Aug 28;23:608-614. doi: 10.12659/AOT.910298.
• [12] Posterior reversible encephalopathy syndrome concurrent with human herpesvirus-6B encephalitis after allogeneic hematopoietic stem cell transplantation.J Infect Chemother. 2020 Feb;26(2):265-268. doi: 10.1016/j.jiac.2019.07.016. Epub 2019 Aug 14.
• [13] Impact of HLA Allele Mismatch at HLA-A, -B, -C, and -DRB1 in Single Cord Blood Transplantation.Biol Blood Marrow Transplant. 2020 Mar;26(3):519-528. doi: 10.1016/j.bbmt.2019.11.001. Epub 2019 Nov 9.
• [14] Efficacy and safety of sofosbuvir-based antiviral therapy to treat hepatitis C virus infection after kidney transplantation.Clin Kidney J. 2018 Jun;11(3):429-433. doi: 10.1093/ckj/sfx112. Epub 2017 Oct 30.
• [15] Systematic review with meta-analysis: sirolimus- or everolimus-based immunosuppression following liver transplantation for hepatocellular carcinoma.Aliment Pharmacol Ther. 2019 May;49(10):1260-1273. doi: 10.1111/apt.15253. Epub 2019 Apr 15.
• [16] Meta-Qtest: meta-analysis of quadratic test for rare variants.BMC Med Genomics. 2019 Jul 11;12(Suppl 5):102. doi: 10.1186/s12920-019-0516-5.
• [17] Randomised controlled trial comparing ofatumumab to rituximab in children with steroid-dependent and calcineurin inhibitor-dependent idiopathic nephrotic syndrome: study protocol.BMJ Open. 2017 Mar 17;7(3):e013319. doi: 10.1136/bmjopen-2016-013319.
• [18] Successful treatment of recurrent immunoglobulin a nephropathy using steroid pulse therapy plus tonsillectomy 10years after kidney transplantation: a case presentation.BMC Nephrol. 2018 Mar 14;19(1):64. doi: 10.1186/s12882-018-0858-9.
• [19] Pneumocystis jirovecii Pneumonia in Pediatric Inflammatory Bowel Disease: A Case Report and Literature Review.Front Pediatr. 2017 Jul 24;5:161. doi: 10.3389/fped.2017.00161. eCollection 2017.
• [20] A randomized trial of everolimus-based quadruple therapy vs standard triple therapy early after lung transplantation.Am J Transplant. 2019 Jun;19(6):1759-1769. doi: 10.1111/ajt.15251. Epub 2019 Feb 5.
• [21] Treatment of HCV infection in liver transplant recipients with ledipasvir and sofosbuvir without ribavirin.Aliment Pharmacol Ther. 2017 Jun;45(11):1427-1432. doi: 10.1111/apt.14059. Epub 2017 Apr 6.
• [22] Recurrence of disease following organ transplantation in autoimmune liver disease and systemic lupus erythematosus.Cell Immunol. 2020 Jan;347:104021. doi: 10.1016/j.cellimm.2019.104021. Epub 2019 Nov 16.
• [23] Ex Vivo CD34(+)-Selected T Cell-Depleted Peripheral Blood Stem Cell Grafts for Allogeneic Hematopoietic Stem Cell Transplantation in Acute Leukemia and Myelodysplastic Syndrome Is Associated with Low Incidence of Acute and Chronic Graft-versus-Host Disease and High Treatment Response.Biol Blood Marrow Transplant. 2017 Mar;23(3):452-458. doi: 10.1016/j.bbmt.2016.12.633. Epub 2016 Dec 23.
• [24] Efficacy and safety of tacrolimus and low-dose prednisone in Chinese children with steroid-resistant nephrotic syndrome.World J Pediatr. 2020 Apr;16(2):159-167. doi: 10.1007/s12519-019-00257-z. Epub 2019 May 2.
• [25] A case report of immunoglobulin M nephropathy manifesting as crescentic glomerulonephritis and nephrotic syndrome in an adult.BMC Nephrol. 2019 Aug 27;20(1):335. doi: 10.1186/s12882-019-1528-2.
• [26] Sirolimus for Secondary Prevention of Skin Cancer in Kidney Transplant Recipients: 5-Year Results.J Clin Oncol. 2018 Sep 1;36(25):2612-2620. doi: 10.1200/JCO.2017.76.6691. Epub 2018 Jul 17.
• [27] The effects of calcineurin inhibitor FK506 on actin cytoskeleton, neuronal survival and glial reactions after pilocarpine-induced status epilepticus in mice.Epilepsy Res. 2018 Feb;140:138-147. doi: 10.1016/j.eplepsyres.2018.01.007. Epub 2018 Jan 10.
• [28] Low additive effect of hydroxychloroquine on Japanese patients with systemic lupus erythematosus taking calcineurin inhibitor.Int J Rheum Dis. 2019 Mar;22(3):468-472. doi: 10.1111/1756-185X.13418. Epub 2018 Nov 8.
• [29] Antiphospholipid Syndrome Nephropathy and Other Thrombotic Microangiopathies Among Patients With Systemic Lupus Erythematosus.Adv Chronic Kidney Dis. 2019 Sep;26(5):376-386. doi: 10.1053/j.ackd.2019.08.012.
• [30] Impact of type of calcineurin inhibitor on post-transplant tuberculosis: Single-center study from India.Transpl Infect Dis. 2017 Feb;19(1). doi: 10.1111/tid.12626. Epub 2016 Dec 16.
• [31] Everolimus Use for Intolerance or Failure of Baseline Immunosuppression in Adult Heart and Lung Transplantation.Ann Transplant. 2018 Oct 23;23:744-750. doi: 10.12659/AOT.910952.
• [32] Downregulation of miRNA-15a and miRNA-16 promote tumor proliferation in multiple myeloma by increasing CABIN1 expression.Oncol Lett. 2018 Jan;15(1):1287-1296. doi: 10.3892/ol.2017.7424. Epub 2017 Nov 15.
• [33] Calcineurin inhibitor Tacrolimus impairs host immune response against urinary tract infection.Sci Rep. 2019 Jan 14;9(1):106. doi: 10.1038/s41598-018-37482-x.
• [34] Tissue-specific expression of human calcineurin-binding protein 1 in mouse synovial tissue can suppress inflammatory arthritis.J Interferon Cytokine Res. 2012 Jan;32(1):6-11. doi: 10.1089/jir.2010.0155. Epub 2011 Dec 16.
• [35] Arsenic Trioxide Inhibits the Metastasis of Small Cell Lung Cancer by Blocking Calcineurin-Nuclear Factor of Activated T Cells (NFAT) Signaling.Med Sci Monit. 2019 Mar 26;25:2228-2237. doi: 10.12659/MSM.913091.
• [36] PPP3CB contributes to poor prognosis through activating nuclear factor of activated T-cells signaling in neuroblastoma.Mol Carcinog. 2019 Mar;58(3):426-435. doi: 10.1002/mc.22939. Epub 2018 Dec 13.
• [37] Clinical aspects of tacrolimus use in paediatric renal transplant recipients.Pediatr Nephrol. 2019 Jan;34(1):31-43. doi: 10.1007/s00467-018-3892-8. Epub 2018 Feb 26.
• [38] Genome-wide association analyses in Han Chinese identify two new susceptibility loci for amyotrophic lateral sclerosis.Nat Genet. 2013 Jun;45(6):697-700. doi: 10.1038/ng.2627. Epub 2013 Apr 28.
• [39] Early Postoperative Neutrophil Gelatinase-Associated Lipocalin Predicts the Development of Chronic Kidney Disease After Liver Transplantation.Transplantation. 2018 May;102(5):809-815. doi: 10.1097/TP.0000000000002075.
• [40] Successful treatment of plasma exchange for rapidly progressive interstitial lung disease with anti-MDA5 antibody-positive dermatomyositis: A case report.Medicine (Baltimore). 2018 Apr;97(15):e0436. doi: 10.1097/MD.0000000000010436.
• [41] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [42] Tacrolimus, a calcineurin inhibitor, overcomes treatment unresponsiveness mediated by P-glycoprotein on lymphocytes in refractory rheumatoid arthritis.J Rheumatol. 2010 Mar;37(3):512-20. doi: 10.3899/jrheum.090048. Epub 2010 Jan 15.
• [43] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [44] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [45] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [46] Quantitative proteomic analysis of HepG2 cells treated with quercetin suggests IQGAP1 involved in quercetin-induced regulation of cell proliferation and migration. OMICS. 2009 Apr;13(2):93-103. doi: 10.1089/omi.2008.0075.
• [47] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [48] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [49] Gingival Stromal Cells as an In Vitro Model: Cannabidiol Modulates Genes Linked With Amyotrophic Lateral Sclerosis. J Cell Biochem. 2017 Apr;118(4):819-828. doi: 10.1002/jcb.25757. Epub 2016 Nov 28.
• [50] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [51] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [52] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [53] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.