Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6EJ8MQ)

DOT Name ELAV-like protein 2 (ELAVL2)
Synonyms ELAV-like neuronal protein 1; Hu-antigen B; HuB; Nervous system-specific RNA-binding protein Hel-N1
Gene Name ELAVL2
Related Disease
Melanoma ( )
Small-cell lung cancer ( )
Urinary bladder cancer ( )
Advanced cancer ( )
Alzheimer disease ( )
Aplasia cutis congenita ( )
Bladder cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Cardiac failure ( )
Colorectal carcinoma ( )
Congenital contractural arachnodactyly ( )
Congestive heart failure ( )
Corpus callosum, agenesis of ( )
Epithelial ovarian cancer ( )
Ewing sarcoma ( )
Gastric cancer ( )
Glioblastoma multiforme ( )
Head-neck squamous cell carcinoma ( )
Hepatocellular carcinoma ( )
Lung squamous cell carcinoma ( )
Major depressive disorder ( )
Matthew-Wood syndrome ( )
Nasopharyngeal carcinoma ( )
Non-insulin dependent diabetes ( )
Non-small-cell lung cancer ( )
Osteoarthritis ( )
Osteoporosis ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Pancreatic cancer ( )
Parkinson disease ( )
Rheumatoid arthritis ( )
Schizophrenia ( )
Stomach cancer ( )
Stroke ( )
Ulcerative colitis ( )
Urinary bladder neoplasm ( )
Adult glioblastoma ( )
Endometrial cancer ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Autism spectrum disorder ( )
Clear cell renal carcinoma ( )
Coronary heart disease ( )
Endometrial carcinoma ( )
Esophageal squamous cell carcinoma ( )
Neuralgia ( )
Triple negative breast cancer ( )
UniProt ID
ELAV2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00076
Sequence
METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNLIVNYLPQNMTQEELKSLFG
SIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSA
SIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAE
EAIKGLNGQKPPGATEPITVKFANNPSQKTNQAILSQLYQSPNRRYPGPLAQQAQRFRLD
NLLNMAYGVKRFSPMTIDGMTSLAGINIPGHPGTGWCIFVYNLAPDADESILWQMFGPFG
AVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKTHKA
Function RNA-binding protein that binds to the 3' untranslated region (3'UTR) of target mRNAs. Seems to recognize a GAAA motif. Can bind to its own 3'UTR, the FOS 3'UTR and the ID 3'UTR.
Tissue Specificity Brain; neural-specific.

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Melanoma DIS1RRCY Definitive Genetic Variation [1]
Small-cell lung cancer DISK3LZD Definitive Biomarker [2]
Urinary bladder cancer DISDV4T7 Definitive Biomarker [3]
Advanced cancer DISAT1Z9 Strong Altered Expression [4]
Alzheimer disease DISF8S70 Strong Biomarker [5]
Aplasia cutis congenita DISMDAYM Strong Altered Expression [6]
Bladder cancer DISUHNM0 Strong Biomarker [3]
Breast cancer DIS7DPX1 Strong Altered Expression [7]
Breast carcinoma DIS2UE88 Strong Altered Expression [7]
Cardiac failure DISDC067 Strong Biomarker [8]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [9]
Congenital contractural arachnodactyly DISOM1K7 Strong Biomarker [10]
Congestive heart failure DIS32MEA Strong Biomarker [8]
Corpus callosum, agenesis of DISO9P40 Strong Altered Expression [6]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [11]
Ewing sarcoma DISQYLV3 Strong Biomarker [12]
Gastric cancer DISXGOUK Strong Biomarker [13]
Glioblastoma multiforme DISK8246 Strong Genetic Variation [14]
Head-neck squamous cell carcinoma DISF7P24 Strong Altered Expression [15]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [16]
Lung squamous cell carcinoma DISXPIBD Strong Altered Expression [17]
Major depressive disorder DIS4CL3X Strong Genetic Variation [18]
Matthew-Wood syndrome DISA7HR7 Strong Biomarker [19]
Nasopharyngeal carcinoma DISAOTQ0 Strong Biomarker [20]
Non-insulin dependent diabetes DISK1O5Z Strong Genetic Variation [21]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [22]
Osteoarthritis DIS05URM Strong Biomarker [23]
Osteoporosis DISF2JE0 Strong Altered Expression [24]
Ovarian cancer DISZJHAP Strong Biomarker [25]
Ovarian neoplasm DISEAFTY Strong Biomarker [25]
Pancreatic cancer DISJC981 Strong Biomarker [26]
Parkinson disease DISQVHKL Strong Biomarker [27]
Rheumatoid arthritis DISTSB4J Strong Biomarker [23]
Schizophrenia DISSRV2N Strong Altered Expression [28]
Stomach cancer DISKIJSX Strong Biomarker [13]
Stroke DISX6UHX Strong Genetic Variation [29]
Ulcerative colitis DIS8K27O Strong Genetic Variation [30]
Urinary bladder neoplasm DIS7HACE Strong Biomarker [3]
Adult glioblastoma DISVP4LU Disputed Biomarker [31]
Endometrial cancer DISW0LMR Disputed Biomarker [32]
Arteriosclerosis DISK5QGC Limited Biomarker [33]
Atherosclerosis DISMN9J3 Limited Biomarker [33]
Autism spectrum disorder DISXK8NV Limited Genetic Variation [34]
Clear cell renal carcinoma DISBXRFJ Limited Genetic Variation [35]
Coronary heart disease DIS5OIP1 Limited Biomarker [36]
Endometrial carcinoma DISXR5CY Limited Biomarker [32]
Esophageal squamous cell carcinoma DIS5N2GV Limited Biomarker [37]
Neuralgia DISWO58J Limited Genetic Variation [38]
Triple negative breast cancer DISAMG6N Limited Biomarker [39]
------------------------------------------------------------------------------------
⏷ Show the Full List of 49 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of ELAV-like protein 2 (ELAVL2). [40]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of ELAV-like protein 2 (ELAVL2). [42]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of ELAV-like protein 2 (ELAVL2). [41]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of ELAV-like protein 2 (ELAVL2). [43]
geraniol DMS3CBD Investigative geraniol decreases the expression of ELAV-like protein 2 (ELAVL2). [44]
------------------------------------------------------------------------------------

References

1 Prognostic genes of melanoma identified by weighted gene co-expression network analysis and drug repositioning using a network-based method.Oncol Lett. 2019 Dec;18(6):6066-6078. doi: 10.3892/ol.2019.10961. Epub 2019 Oct 4.
2 Comprehensive genomic analysis identifies SOX2 as a frequently amplified gene in small-cell lung cancer.Nat Genet. 2012 Oct;44(10):1111-6. doi: 10.1038/ng.2405. Epub 2012 Sep 2.
3 Four novel biomarkers for bladder cancer identified by weighted gene coexpression network analysis.J Cell Physiol. 2019 Aug;234(10):19073-19087. doi: 10.1002/jcp.28546. Epub 2019 Mar 29.
4 Estrogen receptor 1 and progesterone receptor are distinct biomarkers and prognostic factors in estrogen receptor-positive breast cancer: Evidence from a bioinformatic analysis.Biomed Pharmacother. 2020 Jan;121:109647. doi: 10.1016/j.biopha.2019.109647. Epub 2019 Nov 13.
5 Identification of molecular signatures and pathways to identify novel therapeutic targets in Alzheimer's disease: Insights from a systems biomedicine perspective.Genomics. 2020 Mar;112(2):1290-1299. doi: 10.1016/j.ygeno.2019.07.018. Epub 2019 Aug 1.
6 Identification of key modules and prognostic markers in adrenocortical carcinoma by weighted gene co-expression network analysis.Oncol Lett. 2019 Oct;18(4):3673-3681. doi: 10.3892/ol.2019.10725. Epub 2019 Aug 6.
7 Identification of lncRNA TRPM2-AS/miR-140-3p/PYCR1 axis's proliferates and anti-apoptotic effect on breast cancer using co-expression network analysis.Cancer Biol Ther. 2019;20(6):760-773. doi: 10.1080/15384047.2018.1564563. Epub 2019 Feb 27.
8 Weighted Gene Co-Expression Network Analysis Identifies Critical Genes in the Development of Heart Failure After Acute Myocardial Infarction.Front Genet. 2019 Nov 26;10:1214. doi: 10.3389/fgene.2019.01214. eCollection 2019.
9 A network-based predictive gene expression signature for recurrence risks in stage II colorectal cancer.Cancer Med. 2020 Jan;9(1):179-193. doi: 10.1002/cam4.2642. Epub 2019 Nov 14.
10 Five Hub Genes Can Be The Potential DNA Methylation Biomarkers For Cholangiocarcinoma Using Bioinformatics Analysis.Onco Targets Ther. 2019 Oct 11;12:8355-8365. doi: 10.2147/OTT.S203342. eCollection 2019.
11 Mining Featured Biomarkers Linked with Epithelial Ovarian CancerBased on Bioinformatics.Diagnostics (Basel). 2019 Apr 9;9(2):39. doi: 10.3390/diagnostics9020039.
12 Identifying prognosis and metastasis-associated genes associated with Ewing sarcoma by weighted gene co-expression network analysis.Oncol Lett. 2019 Oct;18(4):3527-3536. doi: 10.3892/ol.2019.10681. Epub 2019 Jul 29.
13 Identification of specific modules and hub genes associated with the progression of gastric cancer.Carcinogenesis. 2019 Oct 16;40(10):1269-1277. doi: 10.1093/carcin/bgz040.
14 PBK as a Potential Biomarker Associated with Prognosis of Glioblastoma.J Mol Neurosci. 2020 Jan;70(1):56-64. doi: 10.1007/s12031-019-01400-1. Epub 2019 Oct 15.
15 Integrative Bioinformatics Analysis Identifies NEK2 as a Potential Biomarker in Head and Neck Squamous Cell Carcinoma.J Comput Biol. 2020 Jan;27(1):100-108. doi: 10.1089/cmb.2019.0208. Epub 2019 Aug 28.
16 Identification of potential hub genes related to the progression and prognosis of hepatocellular carcinoma through integrated bioinformatics analysis.Oncol Rep. 2020 Jan;43(1):133-146. doi: 10.3892/or.2019.7400. Epub 2019 Nov 6.
17 Five genes may predict metastasis in non-small cell lung cancer using bioinformatics analysis.Oncol Lett. 2019 Aug;18(2):1723-1732. doi: 10.3892/ol.2019.10498. Epub 2019 Jun 19.
18 Genome-wide meta-analysis of depression identifies 102 independent variants and highlights the importance of the prefrontal brain regions.Nat Neurosci. 2019 Mar;22(3):343-352. doi: 10.1038/s41593-018-0326-7. Epub 2019 Feb 4.
19 Construction of a circRNA-miRNA-mRNA network to explore the pathogenesis and treatment of pancreatic ductal adenocarcinoma.J Cell Biochem. 2020 Jan;121(1):394-406. doi: 10.1002/jcb.29194. Epub 2019 Jun 24.
20 Bioinformatics analysis identifies hub genes and pathways in nasopharyngeal carcinoma.Oncol Lett. 2019 Oct;18(4):3637-3645. doi: 10.3892/ol.2019.10707. Epub 2019 Aug 2.
21 Comprehensive transcriptomic analysis indicates brain regional specific alterations in type 2 diabetes.Aging (Albany NY). 2019 Aug 26;11(16):6398-6421. doi: 10.18632/aging.102196. Epub 2019 Aug 26.
22 Identification of key microRNAs and hub genes in non-small-cell lung cancer using integrative bioinformatics and functional analyses.J Cell Biochem. 2020 Mar;121(3):2690-2703. doi: 10.1002/jcb.29489. Epub 2019 Nov 6.
23 Analysis of differentially expressed genes in rheumatoid arthritis and osteoarthritis by integrated microarray analysis.J Cell Biochem. 2019 Aug;120(8):12653-12664. doi: 10.1002/jcb.28533. Epub 2019 Mar 4.
24 Gene co-expression network analysis identifies BRCC3 as a key regulator in osteogenic differentiation of osteoblasts through a -catenin signaling dependent pathway.Iran J Basic Med Sci. 2019 Feb;22(2):173-178. doi: 10.22038/IJBMS.2018.29498.7123.
25 Identifying Gene Network Rewiring by Integrating Gene Expression and Gene Network Data.IEEE/ACM Trans Comput Biol Bioinform. 2018 Nov-Dec;15(6):2079-2085. doi: 10.1109/TCBB.2018.2809603. Epub 2018 Feb 26.
26 Identification of Acute Pancreatitis-Related Genes and Pathways by Integrated Bioinformatics Analysis.Dig Dis Sci. 2020 Jun;65(6):1720-1732. doi: 10.1007/s10620-019-05928-5. Epub 2019 Nov 13.
27 Aberrantly expressed long noncoding RNAs and genes in Parkinson's disease.Neuropsychiatr Dis Treat. 2018 Nov 22;14:3219-3229. doi: 10.2147/NDT.S178435. eCollection 2018.
28 Identification of relevant hub genes for early intervention at gene coexpression modules with altered predicted expression in schizophrenia.Prog Neuropsychopharmacol Biol Psychiatry. 2020 Mar 2;98:109815. doi: 10.1016/j.pnpbp.2019.109815. Epub 2019 Nov 9.
29 Bioinformatic gene analysis for potential biomarkers and therapeutic targets of atrial fibrillation-related stroke.J Transl Med. 2019 Feb 13;17(1):45. doi: 10.1186/s12967-019-1790-x.
30 Analysis of Genes Involved in Ulcerative Colitis Activity and Tumorigenesis Through Systematic Mining of Gene Co-expression Networks.Front Physiol. 2019 May 31;10:662. doi: 10.3389/fphys.2019.00662. eCollection 2019.
31 Identification of differentially expressed key genes between glioblastoma and low-grade glioma by bioinformatics analysis.PeerJ. 2019 Mar 7;7:e6560. doi: 10.7717/peerj.6560. eCollection 2019.
32 Clinical and Expression Significance of AKT1 by Co-expression Network Analysis in Endometrial Cancer.Front Oncol. 2019 Nov 6;9:1147. doi: 10.3389/fonc.2019.01147. eCollection 2019.
33 TPM2 as a potential predictive biomarker for atherosclerosis.Aging (Albany NY). 2019 Sep 5;11(17):6960-6982. doi: 10.18632/aging.102231. Epub 2019 Sep 5.
34 Integrated Transcriptome Analyses Revealed Key Target Genes in Mouse Models of Autism.Autism Res. 2020 Mar;13(3):352-368. doi: 10.1002/aur.2240. Epub 2019 Nov 19.
35 Construction and analysis of circular RNA molecular regulatory networks in clear cell renal cell carcinoma.Mol Med Rep. 2020 Jan;21(1):141-150. doi: 10.3892/mmr.2019.10811. Epub 2019 Nov 11.
36 Identification of a blood-based 12-gene signature that predicts the severity of coronary artery stenosis: An integrative approach based on gene network construction, Support Vector Machine algorithm, and multi-cohort validation.Atherosclerosis. 2019 Dec;291:34-43. doi: 10.1016/j.atherosclerosis.2019.10.001. Epub 2019 Oct 9.
37 Integrative genomics analysis of hub genes and their relationship with prognosis and signaling pathways in esophageal squamous cell carcinoma.Mol Med Rep. 2019 Oct;20(4):3649-3660. doi: 10.3892/mmr.2019.10608. Epub 2019 Aug 23.
38 Identification of Key Pathways and Genes in L4 Dorsal Root Ganglion (DRG) After Sciatic Nerve Injury via Microarray Analysis.J Invest Surg. 2020 Feb;33(2):172-180. doi: 10.1080/08941939.2018.1452996. Epub 2018 Apr 19.
39 Weighted correlation network analysis of triple-negative breast cancer progression: Identifying specific modules and hub genes based on the GEO and TCGA database.Oncol Lett. 2019 Aug;18(2):1207-1217. doi: 10.3892/ol.2019.10407. Epub 2019 May 27.
40 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
41 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
42 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
43 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
44 Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.