Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8C98UZ)

• DOT Name: ETS translocation variant 4 (ETV4)
• Synonyms: Adenovirus E1A enhancer-binding protein; E1A-F; Polyomavirus enhancer activator 3 homolog; Protein PEA3
• Gene Name: ETV4
• Related Disease:
  Melanoma
  Thyroid gland papillary carcinoma
  Adenocarcinoma
  Adult glioblastoma
  Advanced cancer
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cholangiocarcinoma
  Colon cancer
  Colon carcinoma
  Colorectal neoplasm
  Congenital contractural arachnodactyly
  Epithelial ovarian cancer
  Gastric cancer
  Glioblastoma multiforme
  Glioma
  HER2/NEU overexpressing breast cancer
  Immunodeficiency
  Lung adenocarcinoma
  Lung squamous cell carcinoma
  Malignant soft tissue neoplasm
  Non-small-cell lung cancer
  Oral cancer
  Ovarian cancer
  Ovarian neoplasm
  Pancreatic tumour
  Prostate carcinoma
  Prostate neoplasm
  Sarcoma
  Squamous cell carcinoma
  Stomach cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Acute myelogenous leukaemia
  Gastrointestinal stromal tumour
  Hepatocellular carcinoma
  Neuroblastoma
  Pancreatic cancer
  Rhabdomyosarcoma
  Small-cell lung cancer
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Metastatic malignant neoplasm
  Carcinoma
  Esophageal adenocarcinoma
• UniProt ID: ETV4_HUMAN
• PDB ID: 4CO8; 4UUV; 5ILU
• Pfam ID: PF00178 ; PF04621
• Sequence:
  MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMDPGSLPPLDSEDLFQDLSHF
  QETWLAEAQVPDSDEQFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHH
  GEQCLYSSAYDPPRQIAIKSPAPGALGQSPLQPFPRAEQRNFLRSSGTSQPHPGHGYLGE
  HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYHDPLYEQAGQP
  AVDQGGVNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLHTEGFSGPSPGDGAMGYGYE
  KPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFI
  AWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKF
  VCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKG
  GYSY
• Function: Transcriptional activator. May play a role in keratinocyte differentiation ; (Microbial infection) Binds to the enhancer of the adenovirus E1A gene and acts as a transcriptional activator; the core-binding sequence is 5'-[AC]GGA[AT]GT-3'.
• Tissue Specificity: Expressed in keratinocytes.
• KEGG Pathway: Transcriptio.l misregulation in cancer (hsa05202)
• Reactome Pathway: MAPK6/MAPK4 signaling (R-HSA-5687128)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Melanoma	DIS1RRCY	Definitive	Altered Expression	[1]
Thyroid gland papillary carcinoma	DIS48YMM	Definitive	Biomarker	[2]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[3]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[7]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[8]
Cholangiocarcinoma	DIS71F6X	Strong	Altered Expression	[9]
Colon cancer	DISVC52G	Strong	Biomarker	[10]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[10]
Colorectal neoplasm	DISR1UCN	Strong	Altered Expression	[11]
Congenital contractural arachnodactyly	DISOM1K7	Strong	Altered Expression	[9]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[12]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[13]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[4]
Glioma	DIS5RPEH	Strong	Biomarker	[14]
HER2/NEU overexpressing breast cancer	DISYKID5	Strong	Altered Expression	[15]
Immunodeficiency	DIS093I0	Strong	Biomarker	[8]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[16]
Lung squamous cell carcinoma	DISXPIBD	Strong	Biomarker	[17]
Malignant soft tissue neoplasm	DISTC6NO	Strong	Biomarker	[18]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[17]
Oral cancer	DISLD42D	Strong	Biomarker	[19]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[12]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[12]
Pancreatic tumour	DIS3U0LK	Strong	Altered Expression	[20]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[21]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[22]
Sarcoma	DISZDG3U	Strong	Biomarker	[18]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[23]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[13]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[6]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[6]
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[24]
Gastrointestinal stromal tumour	DIS6TJYS	moderate	Altered Expression	[25]
Hepatocellular carcinoma	DIS0J828	moderate	Biomarker	[26]
Neuroblastoma	DISVZBI4	moderate	Altered Expression	[27]
Pancreatic cancer	DISJC981	moderate	Biomarker	[28]
Rhabdomyosarcoma	DISNR7MS	moderate	Biomarker	[29]
Small-cell lung cancer	DISK3LZD	moderate	Biomarker	[30]
Lung cancer	DISCM4YA	Disputed	Biomarker	[17]
Lung carcinoma	DISTR26C	Disputed	Biomarker	[17]
Lung neoplasm	DISVARNB	Disputed	Altered Expression	[31]
Metastatic malignant neoplasm	DIS86UK6	Disputed	Altered Expression	[32]
Carcinoma	DISH9F1N	Limited	Altered Expression	[33]
Esophageal adenocarcinoma	DISODWFP	Limited	Altered Expression	[34]

27 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of ETS translocation variant 4 (ETV4).	[35]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of ETS translocation variant 4 (ETV4).	[36]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of ETS translocation variant 4 (ETV4).	[37]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of ETS translocation variant 4 (ETV4).	[38]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of ETS translocation variant 4 (ETV4).	[39]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of ETS translocation variant 4 (ETV4).	[40]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of ETS translocation variant 4 (ETV4).	[41]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of ETS translocation variant 4 (ETV4).	[42]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of ETS translocation variant 4 (ETV4).	[43]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of ETS translocation variant 4 (ETV4).	[44]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of ETS translocation variant 4 (ETV4).	[45]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of ETS translocation variant 4 (ETV4).	[46]
Orlistat	DMRJSP8	Approved	Orlistat increases the expression of ETS translocation variant 4 (ETV4).	[47]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of ETS translocation variant 4 (ETV4).	[48]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the activity of ETS translocation variant 4 (ETV4).	[49]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol increases the expression of ETS translocation variant 4 (ETV4).	[42]
PD-0325901	DM27D4J	Phase 2	PD-0325901 decreases the expression of ETS translocation variant 4 (ETV4).	[50]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of ETS translocation variant 4 (ETV4).	[51]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of ETS translocation variant 4 (ETV4).	[52]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of ETS translocation variant 4 (ETV4).	[53]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of ETS translocation variant 4 (ETV4).	[55]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of ETS translocation variant 4 (ETV4).	[57]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of ETS translocation variant 4 (ETV4).	[59]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of ETS translocation variant 4 (ETV4).	[60]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of ETS translocation variant 4 (ETV4).	[61]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE increases the expression of ETS translocation variant 4 (ETV4).	[40]
Nitrobenzanthrone	DMN6L70	Investigative	Nitrobenzanthrone increases the expression of ETS translocation variant 4 (ETV4).	[62]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of ETS translocation variant 4 (ETV4).	[54]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of ETS translocation variant 4 (ETV4).	[56]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of ETS translocation variant 4 (ETV4).	[58]

References

• [1] Melanoma cell adhesion molecule is the driving force behind the dissemination of melanoma upon S100A8/A9 binding in the original skin lesion.Cancer Lett. 2019 Jun 28;452:178-190. doi: 10.1016/j.canlet.2019.03.023. Epub 2019 Mar 21.
• [2] Identification of potential functional genes in papillary thyroid cancer by co-expression network analysis.Oncol Lett. 2018 Oct;16(4):4871-4878. doi: 10.3892/ol.2018.9306. Epub 2018 Aug 14.
• [3] PEA3/ETV4-related transcription factors coupled with active ERK signalling are associated with poor prognosis in gastric adenocarcinoma.Br J Cancer. 2011 Jun 28;105(1):124-30. doi: 10.1038/bjc.2011.187. Epub 2011 Jun 14.
• [4] Regulation of the urokinase-type plasminogen activator receptor gene in different grades of human glioma cell lines.Clin Cancer Res. 2001 Feb;7(2):267-76.
• [5] ETV1 induces epithelial to mesenchymal transition in human gastric cancer cells through the upregulation of Snail expression.Oncol Rep. 2013 Dec;30(6):2859-63. doi: 10.3892/or.2013.2776. Epub 2013 Oct 2.
• [6] Transcriptional regulatory networks in human lung adenocarcinoma.Mol Med Rep. 2012 Nov;6(5):961-6. doi: 10.3892/mmr.2012.1034. Epub 2012 Aug 14.
• [7] Critical role of the MCAM-ETV4 axis triggered by extracellular S100A8/A9 in breast cancer aggressiveness.Neoplasia. 2019 Jul;21(7):627-640. doi: 10.1016/j.neo.2019.04.006. Epub 2019 May 14.
• [8] ETV4 transcription factor and MMP13 metalloprotease are interplaying actors of breast tumorigenesis.Breast Cancer Res. 2018 Jul 11;20(1):73. doi: 10.1186/s13058-018-0992-0.
• [9] Increased ETV4 expression correlates with estrogen-enhanced proliferation and invasiveness of cholangiocarcinoma cells.Cancer Cell Int. 2018 Feb 20;18:25. doi: 10.1186/s12935-018-0525-z. eCollection 2018.
• [10] ETV4 and Myeov knockdown impairs colon cancer cell line proliferation and invasion.Biochem Biophys Res Commun. 2006 Jun 23;345(1):216-21. doi: 10.1016/j.bbrc.2006.04.094. Epub 2006 Apr 27.
• [11] Association of Ets-related transcriptional factor E1AF expression with overexpression of matrix metalloproteinases, COX-2 and iNOS in the early stage of colorectal carcinogenesis.Carcinogenesis. 2005 May;26(5):892-9. doi: 10.1093/carcin/bgi029. Epub 2005 Feb 3.
• [12] PEA3 is necessary for optimal epidermal growth factor receptor-stimulated matrix metalloproteinase expression and invasion of ovarian tumor cells.Mol Cancer Res. 2007 May;5(5):413-21. doi: 10.1158/1541-7786.MCR-07-0019. Epub 2007 May 2.
• [13] Expression of ets-related transcriptional factor E1AF is associated with tumor progression and over-expression of matrilysin in human gastric cancer.Carcinogenesis. 2004 Mar;25(3):325-32. doi: 10.1093/carcin/bgh011. Epub 2003 Nov 6.
• [14] Functional interaction of E1AF and Sp1 in glioma invasion.Mol Cell Biol. 2007 Dec;27(24):8770-82. doi: 10.1128/MCB.02302-06. Epub 2007 Oct 15.
• [15] Simvastatin downregulates HER2 via upregulation of PEA3 to induce cell death in HER2-positive breast cancer cells.Oncol Res. 2012;20(5-6):187-95. doi: 10.3727/096504013x13589503482699.
• [16] ETV4 promotes proliferation and invasion of lung adenocarcinoma by transcriptionally upregulating MSI2.Biochem Biophys Res Commun. 2019 Aug 13;516(1):278-284. doi: 10.1016/j.bbrc.2019.06.115. Epub 2019 Jun 25.
• [17] ETV4 overexpression promotes progression of non-small cell lung cancer by upregulating PXN and MMP1 transcriptionally.Mol Carcinog. 2020 Jan;59(1):73-86. doi: 10.1002/mc.23130. Epub 2019 Oct 31.
• [18] The utility of ETV1, ETV4 and ETV5 RNA in-situ hybridization in the diagnosis of CIC-DUX sarcomas.Histopathology. 2017 Mar;70(4):657-663. doi: 10.1111/his.13112. Epub 2016 Dec 16.
• [19] Antisense E1AF transfection restrains oral cancer invasion by reducing matrix metalloproteinase activities.Am J Pathol. 1997 Jun;150(6):2125-32.
• [20] The antagonistic regulation of human MUC4 and ErbB-2 genes by the Ets protein PEA3 in pancreatic cancer cells: implications for the proliferation/differentiation balance in the cells.Biochem J. 2005 Feb 15;386(Pt 1):35-45. doi: 10.1042/BJ20040706.
• [21] Clonal evaluation of early onset prostate cancer by expression profiling of ERG, SPINK1, ETV1, and ETV4 on whole-mount radical prostatectomy tissue.Prostate. 2020 Jan;80(1):38-50. doi: 10.1002/pros.23914. Epub 2019 Oct 4.
• [22] An Interaction with Ewing's Sarcoma Breakpoint Protein EWS Defines a Specific Oncogenic Mechanism of ETS Factors Rearranged in Prostate Cancer.Cell Rep. 2016 Oct 25;17(5):1289-1301. doi: 10.1016/j.celrep.2016.10.001.
• [23] SOX2 and p63 colocalize at genetic loci in squamous cell carcinomas.J Clin Invest. 2014 Apr;124(4):1636-45. doi: 10.1172/JCI71545. Epub 2014 Mar 3.
• [24] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [25] ETV4 collaborates with Wnt/-catenin signaling to alter cell cycle activity and promote tumor aggressiveness in gastrointestinal stromal tumor.Oncotarget. 2017 Dec 11;8(69):114195-114209. doi: 10.18632/oncotarget.23173. eCollection 2017 Dec 26.
• [26] PBK overexpression promotes metastasis of hepatocellular carcinoma via activating ETV4-uPAR signaling pathway.Cancer Lett. 2019 Jun 28;452:90-102. doi: 10.1016/j.canlet.2019.03.028. Epub 2019 Mar 23.
• [27] Two transcription factors, E1AF and N-myc, correlate with the invasiveness of neuroblastoma cell lines.Jpn J Cancer Res. 1997 Apr;88(4):394-400. doi: 10.1111/j.1349-7006.1997.tb00395.x.
• [28] ETV4 Facilitates Cell-Cycle Progression in Pancreatic Cells through Transcriptional Regulation of Cyclin D1.Mol Cancer Res. 2018 Feb;16(2):187-196. doi: 10.1158/1541-7786.MCR-17-0219. Epub 2017 Nov 8.
• [29] Differentiating Ewing's sarcoma from other round blue cell tumors using a RT-PCR translocation panel on formalin-fixed paraffin-embedded tissues.Mod Pathol. 2007 Mar;20(3):397-404. doi: 10.1038/modpathol.3800755.
• [30] Evaluation of ETV4 and WT1 expression in CIC-rearranged sarcomas and histologic mimics.Mod Pathol. 2016 Nov;29(11):1324-1334. doi: 10.1038/modpathol.2016.140. Epub 2016 Jul 22.
• [31] Increased PEA3/E1AF and decreased Net/Elk-3, both ETS proteins, characterize human NSCLC progression and regulate caveolin-1 transcription in Calu-1 and NCI-H23 NSCLC cell lines.Carcinogenesis. 2009 Aug;30(8):1433-42. doi: 10.1093/carcin/bgp129. Epub 2009 May 29.
• [32] CIC-DUX4 oncoprotein drives sarcoma metastasis and tumorigenesis via distinct regulatory programs.J Clin Invest. 2019 Jul 22;129(8):3401-3406. doi: 10.1172/JCI126366. eCollection 2019 Jul 22.
• [33] The clinical role of the PEA3 transcription factor in ovarian and breast carcinoma in effusions.Clin Exp Metastasis. 2004;21(3):191-9. doi: 10.1023/b:clin.0000037703.37275.35.
• [34] The ERK MAP kinase-PEA3/ETV4-MMP-1 axis is operative in oesophageal adenocarcinoma.Mol Cancer. 2010 Dec 9;9:313. doi: 10.1186/1476-4598-9-313.
• [35] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [36] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [37] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [38] Altered ErbB receptor signaling and gene expression in cisplatin-resistant ovarian cancer. Cancer Res. 2005 Aug 1;65(15):6789-800. doi: 10.1158/0008-5472.CAN-04-2684.
• [39] Persistent and non-persistent changes in gene expression result from long-term estrogen exposure of MCF-7 breast cancer cells. J Steroid Biochem Mol Biol. 2011 Feb;123(3-5):140-50.
• [40] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [41] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [42] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [43] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [44] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [45] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [46] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [47] Antitumoral actions of the anti-obesity drug orlistat (XenicalTM) in breast cancer cells: blockade of cell cycle progression, promotion of apoptotic cell death and PEA3-mediated transcriptional repression of Her2/neu (erbB-2) oncogene. Ann Oncol. 2005 Aug;16(8):1253-67. doi: 10.1093/annonc/mdi239. Epub 2005 May 3.
• [48] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [49] Biological effects of the plant-derived polyphenol resveratrol in human articular cartilage and chondrosarcoma cells. J Cell Physiol. 2012 Oct;227(10):3488-97. doi: 10.1002/jcp.24049.
• [50] PRC2 loss amplifies Ras-driven transcription and confers sensitivity to BRD4-based therapies. Nature. 2014 Oct 9;514(7521):247-51.
• [51] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [52] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [53] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [54] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [55] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [56] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [57] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [58] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [59] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [60] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [61] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [62] 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.