Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8WQ83R)

• DOT Name: Tetraspanin-31 (TSPAN31)
• Synonyms: Tspan-31; Sarcoma-amplified sequence
• Gene Name: TSPAN31
• Related Disease:
  Prostate cancer
  Prostate carcinoma
  Acute myocardial infarction
  Adult glioblastoma
  Alzheimer disease
  Arteriosclerosis
  Atherosclerosis
  Atrial fibrillation
  Attention deficit hyperactivity disorder
  Breast cancer
  Breast carcinoma
  Carcinoma of esophagus
  Cognitive impairment
  Congestive heart failure
  Depression
  Epilepsy
  Esophageal cancer
  Gastric cancer
  Glioma
  Head and neck cancer
  Head and neck carcinoma
  Head-neck squamous cell carcinoma
  Hepatitis B virus infection
  Hepatocellular carcinoma
  Liposarcoma
  Malignant soft tissue neoplasm
  Multiple sclerosis
  Myelodysplastic syndrome
  Neoplasm
  Neoplasm of esophagus
  Neuroblastoma
  Non-insulin dependent diabetes
  Obesity
  Obstructive sleep apnea
  Osteosarcoma
  Psoriasis
  Sarcoma
  Sleep apnea syndrome
  Soft tissue neoplasm
  Squamous cell carcinoma
  Stomach cancer
  Stroke
  Bone osteosarcoma
  Glioblastoma multiforme
  Liver cirrhosis
  Metastatic malignant neoplasm
  Polycystic ovarian syndrome
• UniProt ID: TSN31_HUMAN
• Pfam ID: PF00335
• Sequence:
  MVCGGFACSKNALCALNVVYMLVSLLLIGVAAWGKGLGLVSSIHIIGGVIAVGVFLLLIA
  VAGLVGAVNHHQVLLFFYMIILGLVFIFQFVISCSCLAINRSKQTDVINASWWVMSNKTR
  DELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGL
  FFSFTEILGVWLAMRFRNQKDPRANPSAFL

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Prostate cancer	DISF190Y	Definitive	Biomarker	[1]
Prostate carcinoma	DISMJPLE	Definitive	Biomarker	[1]
Acute myocardial infarction	DISE3HTG	Strong	Genetic Variation	[2]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[5]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[5]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[6]
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Biomarker	[7]
Breast cancer	DIS7DPX1	Strong	Biomarker	[8]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[8]
Carcinoma of esophagus	DISS6G4D	Strong	Genetic Variation	[9]
Cognitive impairment	DISH2ERD	Strong	Biomarker	[4]
Congestive heart failure	DIS32MEA	Strong	Genetic Variation	[10]
Depression	DIS3XJ69	Strong	Biomarker	[11]
Epilepsy	DISBB28L	Strong	Biomarker	[12]
Esophageal cancer	DISGB2VN	Strong	Genetic Variation	[9]
Gastric cancer	DISXGOUK	Strong	Genetic Variation	[13]
Glioma	DIS5RPEH	Strong	Biomarker	[14]
Head and neck cancer	DISBPSQZ	Strong	Biomarker	[15]
Head and neck carcinoma	DISOU1DS	Strong	Biomarker	[15]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Altered Expression	[16]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[17]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[18]
Liposarcoma	DIS8IZVM	Strong	Genetic Variation	[19]
Malignant soft tissue neoplasm	DISTC6NO	Strong	Biomarker	[20]
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[21]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[22]
Neoplasm	DISZKGEW	Strong	Biomarker	[23]
Neoplasm of esophagus	DISOLKAQ	Strong	Genetic Variation	[9]
Neuroblastoma	DISVZBI4	Strong	Biomarker	[24]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[25]
Obesity	DIS47Y1K	Strong	Biomarker	[26]
Obstructive sleep apnea	DIS0SVD1	Strong	Biomarker	[27]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[20]
Psoriasis	DIS59VMN	Strong	Biomarker	[28]
Sarcoma	DISZDG3U	Strong	Biomarker	[20]
Sleep apnea syndrome	DISER6KS	Strong	Genetic Variation	[10]
Soft tissue neoplasm	DISP2OHE	Strong	Biomarker	[29]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[30]
Stomach cancer	DISKIJSX	Strong	Genetic Variation	[13]
Stroke	DISX6UHX	Strong	Biomarker	[31]
Bone osteosarcoma	DIST1004	Disputed	Biomarker	[32]
Glioblastoma multiforme	DISK8246	Limited	Biomarker	[33]
Liver cirrhosis	DIS4G1GX	Limited	Genetic Variation	[18]
Metastatic malignant neoplasm	DIS86UK6	Limited	Genetic Variation	[34]
Polycystic ovarian syndrome	DISZ2BNG	Limited	Genetic Variation	[35]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Tetraspanin-31 (TSPAN31).	[36]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Tetraspanin-31 (TSPAN31).	[37]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Tetraspanin-31 (TSPAN31).	[38]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Tetraspanin-31 (TSPAN31).	[39]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Tetraspanin-31 (TSPAN31).	[40]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Tetraspanin-31 (TSPAN31).	[41]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Tetraspanin-31 (TSPAN31).	[40]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Tetraspanin-31 (TSPAN31).	[39]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Tetraspanin-31 (TSPAN31).	[42]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Tetraspanin-31 (TSPAN31).	[43]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of Tetraspanin-31 (TSPAN31).	[44]

References

• [1] Lapatinib-resistant cancer cells possessing epithelial cancer stem cell properties develop sensitivity during sphere formation by activation of the ErbB/AKT/cyclinD2 pathway.Oncol Rep. 2016 Nov;36(5):3058-3064. doi: 10.3892/or.2016.5073. Epub 2016 Sep 7.
• [2] One-Year Clinical Outcomes of Patients Presenting With ST-Segment Elevation Myocardial Infarction Caused by Bifurcation Culprit Lesions Treated With the Stentys Self-Apposing Coronary Stent: Results From the APPOSITION III Study.J Invasive Cardiol. 2017 Aug;29(8):253-258.
• [3] Amplification of multiple genes from chromosomal region 12q13-14 in human malignant gliomas: preliminary mapping of the amplicons shows preferential involvement of CDK4, SAS, and MDM2.Cancer Res. 1994 Aug 15;54(16):4299-303.
• [4] A Multifunctional Biocompatible Drug Candidate is Highly Effective in Delaying Pathological Signs of Alzheimer's Disease in 5XFAD Mice.J Alzheimers Dis. 2017;58(2):389-400. doi: 10.3233/JAD-161236.
• [5] A SAS macro for the joint modeling of longitudinal outcomes and multiple competing risk dropouts.Comput Methods Programs Biomed. 2017 Jan;138:23-30. doi: 10.1016/j.cmpb.2016.10.003. Epub 2016 Oct 18.
• [6] Cardiac autonomic dynamics during sleep are lost in patients with TIA and stroke.J Sleep Res. 2020 Jun;29(3):e12878. doi: 10.1111/jsr.12878. Epub 2019 Jun 13.
• [7] Training Executive, Attention, and Motor Skills (TEAMS): a Preliminary Randomized Clinical Trial of Preschool Youth with ADHD.J Abnorm Child Psychol. 2020 Mar;48(3):375-389. doi: 10.1007/s10802-019-00610-w.
• [8] Evaluation of a New Hydroxyapatite Nanoparticle as a Drug Delivery System to Oral Squamous Cell Carcinoma Cells.Anticancer Res. 2018 Dec;38(12):6715-6720. doi: 10.21873/anticanres.13040.
• [9] Glutathione S-transferase M1 polymorphism and esophageal cancer risk: An updated meta-analysis based on 37 studies.World J Gastroenterol. 2016 Feb 7;22(5):1911-8. doi: 10.3748/wjg.v22.i5.1911.
• [10] Impact of sacubitril-valsartan combination in patients with chronic heart failure and sleep apnoea syndrome: the ENTRESTO-SAS study design.ESC Heart Fail. 2018 Jun;5(3):222-230. doi: 10.1002/ehf2.12270. Epub 2018 Feb 22.
• [11] The synergic relationship of social anxiety, depressive symptoms and waist circumference in adolescents: Mediation analysis.J Affect Disord. 2019 Feb 15;245:241-245. doi: 10.1016/j.jad.2018.10.366. Epub 2018 Nov 2.
• [12] Stigma, emotional aspects, and psychological symptoms in individuals with epilepsy.Epilepsy Behav. 2019 Apr;93:56-59. doi: 10.1016/j.yebeh.2019.01.040. Epub 2019 Mar 1.
• [13] GSTT1 and GSTM1 null genotypes and the risk of gastric cancer: a case-control study in a Chinese population.Cancer Epidemiol Biomarkers Prev. 2000 Jan;9(1):73-80.
• [14] Temozolomide toxicity operates in a xCT/SLC7a11 dependent manner and is fostered by ferroptosis.Oncotarget. 2016 Nov 15;7(46):74630-74647. doi: 10.18632/oncotarget.11858.
• [15] Quantitative proteomics unveiled: Regulation of DNA double strand break repair by EGFR involves PARP1.Radiother Oncol. 2015 Sep;116(3):423-30. doi: 10.1016/j.radonc.2015.09.018. Epub 2015 Sep 25.
• [16] Elevated Na(+)/H(+) exchanger-1 expression enhances the metastatic collective migration of head and neck squamous cell carcinoma cells.Biochem Biophys Res Commun. 2017 Apr 22;486(1):101-107. doi: 10.1016/j.bbrc.2017.03.007. Epub 2017 Mar 6.
• [17] Knowledge, awareness, attitude, and practice of health-care professionals toward hepatitis B disease and vaccination in Saudi Arabia.Hum Vaccin Immunother. 2019;15(12):2816-2823. doi: 10.1080/21645515.2019.1629255. Epub 2019 Sep 3.
• [18] Cannabis use is associated with reduced prevalence of progressive stages of alcoholic liver disease.Liver Int. 2018 Aug;38(8):1475-1486. doi: 10.1111/liv.13696. Epub 2018 Feb 10.
• [19] Deletion in human chromosome region 12q13-15 by integration of human papillomavirus DNA in a cervical carcinoma cell line.J Biol Chem. 1995 Oct 13;270(41):24321-6. doi: 10.1074/jbc.270.41.24321.
• [20] Amplification and protein expression of chromosome 12q13-15 genes in osteosarcomas of the jaws.Oral Oncol. 2001 Oct;37(7):566-71. doi: 10.1016/s1368-8375(00)00130-5.
• [21] Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.Nature. 2011 Aug 10;476(7359):214-9. doi: 10.1038/nature10251.
• [22] Association between mitochondrial DNA haplogroup and myelodysplastic syndromes.Genes Chromosomes Cancer. 2016 Sep;55(9):688-93. doi: 10.1002/gcc.22370. Epub 2016 Jun 21.
• [23] TMEM207 hinders the tumour suppressor function of WWOX in oral squamous cell carcinoma.J Cell Mol Med. 2018 Feb;22(2):1026-1033. doi: 10.1111/jcmm.13456. Epub 2017 Nov 22.
• [24] Molecular cytogenetic characterization and physical mapping of 12q13-15 amplification in human cancers.Genes Chromosomes Cancer. 1996 Dec;17(4):205-14. doi: 10.1002/(SICI)1098-2264(199612)17:4<205::AID-GCC2>3.0.CO;2-7.
• [25] Chronic Osteomyelitis Increases the Incidence of Type 2 Diabetes in Humans and Mice.Int J Biol Sci. 2017 Sep 5;13(9):1192-1202. doi: 10.7150/ijbs.21379. eCollection 2017.
• [26] Diet diversity and nutritional status among adults in southwest China.PLoS One. 2017 Feb 23;12(2):e0172406. doi: 10.1371/journal.pone.0172406. eCollection 2017.
• [27] Heat-moulded versus custom-made mandibular advancement devices for obstructive sleep apnoea: a randomised non-inferiority trial.Thorax. 2019 Jul;74(7):667-674. doi: 10.1136/thoraxjnl-2018-212726. Epub 2019 May 3.
• [28] Comparison of Hospital Anxiety and Depression Scale (HADS) and Zung Self-Rating Anxiety/Depression Scale (SAS/SDS) in Evaluating Anxiety and Depression in Patients with Psoriatic Arthritis.Dermatology. 2020;236(2):170-178. doi: 10.1159/000498848. Epub 2019 Aug 21.
• [29] Genomic profiling of bone and soft tissue tumors with supernumerary ring chromosomes using tiling resolution bacterial artificial chromosome microarrays.Oncogene. 2006 Nov 9;25(53):7106-16. doi: 10.1038/sj.onc.1209693. Epub 2006 May 29.
• [30] Nerve growth factor-induced migration in oral and salivary gland tumour cells utilises the PI3K/Akt signalling pathway: Is there a link to perineural invasion?.J Oral Pathol Med. 2020 Mar;49(3):227-234. doi: 10.1111/jop.12979. Epub 2019 Dec 22.
• [31] Periodic limb movements during sleep in stroke/TIA: Prevalence, course, and cardiovascular burden.Neurology. 2018 May 8;90(19):e1663-e1672. doi: 10.1212/WNL.0000000000005471. Epub 2018 Apr 11.
• [32] Analysis of SAS gene and CDK4 and MDM2 proteins in low-grade osteosarcoma.Cancer Detect Prev. 1999;23(2):129-36. doi: 10.1046/j.1525-1500.1999.09907.x.
• [33] Gene amplification in human gliomas.Glia. 1995 Nov;15(3):289-96. doi: 10.1002/glia.440150309.
• [34] Racial/ethnic disparities in de novo metastases sites and survival outcomes for patients with primary breast, colorectal, and prostate cancer.Cancer Med. 2018 Apr;7(4):1183-1193. doi: 10.1002/cam4.1322. Epub 2018 Feb 26.
• [35] Insulin Resistance in Polycystic Ovary Syndrome Improved by Chinese Medicine Dingkun Pill (): A Randomized Controlled Clinical Trial.Chin J Integr Med. 2019 Apr;25(4):246-251. doi: 10.1007/s11655-018-2947-1. Epub 2019 Jun 25.
• [36] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [37] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [38] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [39] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [40] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [41] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [42] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [43] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [44] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.