Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC1UOHP)

• DOT Name: Cyclic AMP-dependent transcription factor ATF-3 (ATF3)
• Synonyms: cAMP-dependent transcription factor ATF-3; Activating transcription factor 3
• Gene Name: ATF3
• UniProt ID: ATF3_HUMAN
• Pfam ID: PF00170
• Sequence:
  MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSS
  ALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK
  LESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQ
  S
• Function: This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter; [Isoform 2]: Activates transcription presumably by sequestering inhibitory cofactors away from the promoters; [Isoform 3]: Stress-induced isoform, counteracts the transcriptional repression of isoform 1.
• Reactome Pathway:
  Response of EIF2AK4 (GCN2) to amino acid deficiency (R-HSA-9633012)
  Response of EIF2AK1 (HRI) to heme deficiency (R-HSA-9648895)
  ATF4 activates genes in response to endoplasmic reticulum stress (R-HSA-380994)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	Cyclic AMP-dependent transcription factor ATF-3 (ATF3) affects the response to substance of Paclitaxel.	[9]
Rigosertib	DMOSTXF	Phase 3	Cyclic AMP-dependent transcription factor ATF-3 (ATF3) increases the response to substance of Rigosertib.	[77]

99 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[7]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[8]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[9]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[10]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[11]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[12]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[13]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[14]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[15]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[16]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[17]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[18]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[19]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[20]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[21]
Menadione	DMSJDTY	Approved	Menadione increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[12]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[22]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[14]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[23]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[24]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[25]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[26]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[27]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[28]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[29]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[30]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[31]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[32]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[33]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[34]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[35]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[36]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[29]
Simvastatin	DM30SGU	Approved	Simvastatin increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[37]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[38]
Fenofibrate	DMFKXDY	Approved	Fenofibrate increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[29]
Clodronate	DM9Y6X7	Approved	Clodronate decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[29]
Sulindac	DM2QHZU	Approved	Sulindac increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[39]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[40]
Thalidomide	DM70BU5	Approved	Thalidomide increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[41]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[40]
Bicalutamide	DMZMSPF	Approved	Bicalutamide increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[42]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[29]
Dinoprostone	DMTYOPD	Approved	Dinoprostone increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[43]
Docetaxel	DMDI269	Approved	Docetaxel decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[17]
Deoxycholic acid	DM3GYAL	Approved	Deoxycholic acid increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[44]
Clotrimazole	DMMFCIH	Approved	Clotrimazole increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[45]
Nelfinavir mesylate	DMFX6G8	Approved	Nelfinavir mesylate increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[46]
Bromocriptine	DMVE3TK	Approved	Bromocriptine increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[47]
Phenoxybenzamine	DM8KSQH	Approved	Phenoxybenzamine increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[44]
Benzyl benzoate	DMDPYI5	Approved	Benzyl benzoate increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[48]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[49]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[50]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[51]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[52]
Fenretinide	DMRD5SP	Phase 3	Fenretinide increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[53]
Benzylpenicillin	DMS9503	Phase 3	Benzylpenicillin increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[48]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[8]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[54]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[55]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[35]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[56]
Disulfiram	DMCL2OK	Phase 2 Trial	Disulfiram increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[44]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[57]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[58]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[59]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[61]
Eugenol	DM7US1H	Patented	Eugenol increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[35]
Hydroxyqunoline analog 4	DMGQMCZ	Patented	Hydroxyqunoline analog 4 increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[62]
Undecylenic acid derivative 1	DMLJ2HE	Patented	Undecylenic acid derivative 1 increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[48]
BUTAPROST	DMVYNJZ	Patented	BUTAPROST increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[43]
Clioquinol	DM746BZ	Withdrawn from market	Clioquinol increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[44]
Astemizole	DM2HN6Q	Withdrawn from market	Astemizole increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[44]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[63]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[64]
Celastrol	DMWQIJX	Preclinical	Celastrol increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[65]
SC-58125	DM874YU	Terminated	SC-58125 increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[66]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[8]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[14]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[67]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[68]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[51]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[69]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[70]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[71]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[72]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[73]
geraniol	DMS3CBD	Investigative	geraniol increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[74]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[75]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[50]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[76]
Resorcinol	DMM37C0	Investigative	Resorcinol increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[48]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde increases the expression of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[35]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Cyclic AMP-dependent transcription factor ATF-3 (ATF3).	[60]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Expression of copper-responsive genes in HepG2 cells. Mol Cell Biochem. 2005 Nov;279(1-2):141-7.
• [7] p53 hypersensitivity is the predominant mechanism of the unique responsiveness of testicular germ cell tumor (TGCT) cells to cisplatin. PLoS One. 2011 Apr 21;6(4):e19198. doi: 10.1371/journal.pone.0019198.
• [8] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [9] ATF3 inhibits arsenic-induced malignant transformation of human bronchial epithelial cells by attenuating inflammation. Toxicology. 2021 Aug;460:152890. doi: 10.1016/j.tox.2021.152890. Epub 2021 Aug 6.
• [10] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [11] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [12] Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
• [13] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [14] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [15] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [16] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [17] Development and validation of the TGx-HDACi transcriptomic biomarker to detect histone deacetylase inhibitors in human TK6 cells. Arch Toxicol. 2021 May;95(5):1631-1645. doi: 10.1007/s00204-021-03014-2. Epub 2021 Mar 26.
• [18] Characterization of DOK1, a candidate tumor suppressor gene, in epithelial ovarian cancer. Mol Oncol. 2011 Oct;5(5):438-53. doi: 10.1016/j.molonc.2011.07.003. Epub 2011 Jul 26.
• [19] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [20] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [21] Identification of ATF-3, caveolin-1, DLC-1, and NM23-H2 as putative antitumorigenic, progesterone-regulated genes for ovarian cancer cells by gene profiling. Oncogene. 2005 Mar 3;24(10):1774-87. doi: 10.1038/sj.onc.1207991.
• [22] Transcriptional profiling of MCF7 breast cancer cells in response to 5-Fluorouracil: relationship with cell cycle changes and apoptosis, and identification of novel targets of p53. Int J Cancer. 2006 Sep 1;119(5):1164-75.
• [23] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [24] Niclosamide induced cell apoptosis via upregulation of ATF3 and activation of PERK in Hepatocellular carcinoma cells. BMC Gastroenterol. 2016 Feb 25;16:25. doi: 10.1186/s12876-016-0442-3.
• [25] Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
• [26] The proteasome inhibitor bortezomib induces apoptosis in human retinoblastoma cell lines in vitro. Invest Ophthalmol Vis Sci. 2007 Oct;48(10):4706-19. doi: 10.1167/iovs.06-1147.
• [27] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [28] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [29] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [30] Cardiac toxicity from ethanol exposure in human-induced pluripotent stem cell-derived cardiomyocytes. Toxicol Sci. 2019 May 1;169(1):280-292.
• [31] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [32] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [33] Regulation of gene expression by tobacco product preparations in cultured human dermal fibroblasts. Toxicol Appl Pharmacol. 2014 Sep 1;279(2):211-9. doi: 10.1016/j.taap.2014.06.001. Epub 2014 Jun 10.
• [34] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [35] Development of a new in vitro skin sensitization assay (Epidermal Sensitization Assay; EpiSensA) using reconstructed human epidermis. Toxicol In Vitro. 2013 Dec;27(8):2213-24. doi: 10.1016/j.tiv.2013.08.007. Epub 2013 Aug 30.
• [36] Estradiol upregulates activating transcription factor 3, a candidate gene in the etiology of hypospadias. Pediatr Dev Pathol. 2007 Nov-Dec;10(6):446-54. doi: 10.2350/06-04-0079.1.
• [37] Simvastatin inactivates beta1-integrin and extracellular signal-related kinase signaling and inhibits cell proliferation in head and neck squamous cell carcinoma cells. Cancer Sci. 2007 Jun;98(6):890-9.
• [38] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [39] Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
• [40] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [41] Polyunsaturated fatty acids synergize with lipid droplet binding thalidomide analogs to induce oxidative stress in cancer cells. Lipids Health Dis. 2010 Jun 2;9:56. doi: 10.1186/1476-511X-9-56.
• [42] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [43] Prostaglandin E2 down-regulates sirtuin 1 (SIRT1), leading to elevated levels of aromatase, providing insights into the obesity-breast cancer connection. J Biol Chem. 2019 Jan 4;294(1):361-371.
• [44] Identification of novel activators of the metal responsive transcription factor (MTF-1) using a gene expression biomarker in a microarray compendium. Metallomics. 2020 Sep 23;12(9):1400-1415. doi: 10.1039/d0mt00071j.
• [45] Activation of p38 Mitogen-Activated Protein Kinase by Clotrimazole Induces Multidrug Resistance-Associated Protein 3 Activation through a Novel Transcriptional Element. J Pharmacol Exp Ther. 2016 Oct;359(1):102-9. doi: 10.1124/jpet.115.231589. Epub 2016 Aug 9.
• [46] Inhibin beta E is upregulated by drug-induced endoplasmic reticulum stress as a transcriptional target gene of ATF4. Toxicol Appl Pharmacol. 2012 Oct 15;264(2):300-4. doi: 10.1016/j.taap.2012.08.011. Epub 2012 Aug 23.
• [47] Bromocriptine methylate suppresses glial inflammation and moderates disease progression in a mouse model of amyotrophic lateral sclerosis. Exp Neurol. 2011 Nov;232(1):41-52. doi: 10.1016/j.expneurol.2011.08.001. Epub 2011 Aug 16.
• [48] An in vitro skin sensitization assay termed EpiSensA for broad sets of chemicals including lipophilic chemicals and pre/pro-haptens. Toxicol In Vitro. 2017 Apr;40:11-25. doi: 10.1016/j.tiv.2016.12.005. Epub 2016 Dec 10.
• [49] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [50] The expression of transcription factor activating transcription factor 3 in the human prostate and its regulation by androgen in prostate cancer. J Urol. 2006 Apr;175(4):1517-22. doi: 10.1016/S0022-5347(05)00651-8.
• [51] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [52] Gene expression profiling identifies activating transcription factor 3 as a novel contributor to the proapoptotic effect of curcumin. Mol Cancer Ther. 2005 Feb;4(2):233-41.
• [53] The transforming growth factor-beta family members bone morphogenetic protein-2 and macrophage inhibitory cytokine-1 as mediators of the antiangiogenic activity of N-(4-hydroxyphenyl)retinamide. Clin Cancer Res. 2005 Jun 15;11(12):4610-9.
• [54] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [55] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [56] Estrogenic GPR30 signalling induces proliferation and migration of breast cancer cells through CTGF. EMBO J. 2009 Mar 4;28(5):523-32.
• [57] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [58] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [59] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [60] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [61] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [62] Inhibition of histone demethylase KDM4 by ML324 induces apoptosis through the unfolded protein response and Bim upregulation in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Feb 1;353:109806. doi: 10.1016/j.cbi.2022.109806. Epub 2022 Jan 7.
• [63] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [64] Transient receptor potential vanilloid 1 agonists cause endoplasmic reticulum stress and cell death in human lung cells. J Pharmacol Exp Ther. 2007 Jun;321(3):830-8. doi: 10.1124/jpet.107.119412. Epub 2007 Mar 1.
• [65] Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.
• [66] Gene modulation by Cox-1 and Cox-2 specific inhibitors in human colorectal carcinoma cancer cells. Carcinogenesis. 2004 Mar;25(3):349-57.
• [67] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [68] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [69] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [70] Persistence of epigenomic effects after recovery from repeated treatment with two nephrocarcinogens. Front Genet. 2018 Dec 3;9:558.
• [71] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [72] An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.
• [73] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [74] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [75] Microarray Analysis of Gene Expression Alteration in Human Middle Ear Epithelial Cells Induced by Asian Sand Dust. Clin Exp Otorhinolaryngol. 2015 Dec;8(4):345-53. doi: 10.3342/ceo.2015.8.4.345. Epub 2015 Nov 10.
• [76] Aldose reductase decreases endoplasmic reticulum stress in ischemic hearts. Chem Biol Interact. 2009 Mar 16;178(1-3):242-9. doi: 10.1016/j.cbi.2008.10.055. Epub 2008 Nov 11.
• [77] ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.